CAZyme Information: MGYG000004285_00444

Basic Information

• Species: UMGS1670 sp900546215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Anaerotignaceae; UMGS1670; UMGS1670 sp900546215
• CAZyme ID: MGYG000004285_00444
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469		53934.19	7.6384

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004285	2345577	MAG	China	Asia

• Gene Location: Start: 20515; End: 21924 Strand: +

Full Sequence      

MTKAVSLFLDGVGIFFLTYLVIYASYLFLSVAMGAWNLYKRDKMLLIKNELKHDFYFPVS
ILVPAYNEEVTILDSIKSLFNLDYRLYEIIVIDDGSTDKTAETVISFFDMHKVSKPIRLV
LKCQEIEAVYETELDNIRLTLICKKNGGKGDALNVGINASQYPYFLCIDADSMLQRDSLE
RIVQPVMEDDGVIAVGGLIRIAQCISLENGNAVGYHLPWNPLLSMQVMEYDRSFLASRIL
LDAFNGNLIISGAFGLFKKDIAVAVGGYDTYTLGEDMELVMKLHTFSRNNEMKYSIRYEP
NAVCWSQAPSSMGDLAKQRRRWHLGLFQSMMKYRSMFLNPRFGLVGFFSYIYYLIYELFT
PVIEIFGIITIIIAGIFGLLNIPFMIQFYVLYVVYGAVLTITAFFQRIYTQNLKISGSDI
LRAVVICFLESMFFRFVLAFIRSTALLRYSQYKNNWDKIKRERHSEIKL

Enzyme Prediction     

No EC number prediction in MGYG000004285_00444.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	60	202	1.1e-22	0.7
GT2	164	374	1.7e-17	0.949238578680203

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	8.92e-60	61	276	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.19e-50	9	462	9	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	8.27e-45	9	341	3	294	N-glycosyltransferase; Provisional
cd02525	Succinoglycan_BP_ExoA	6.71e-27	59	348	2	248	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
PRK14583	hmsR	6.28e-26	59	355	77	341	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMT19152.1	5.53e-184	1	464	1	464
QNK56534.1	2.09e-183	1	463	1	463
QBE99872.1	3.45e-175	1	463	1	463
QIB55150.1	4.89e-175	1	463	1	463
QMW76995.1	4.89e-175	1	463	1	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.84e-08	59	195	7	118	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
5TZE_C	3.29e-06	60	180	4	102	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	4.46e-06	60	180	4	102	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
6P61_A	9.00e-06	59	177	15	108	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GLC5	8.25e-33	42	332	34	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HKQ0	2.14e-32	42	332	34	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q7A351	3.39e-30	48	332	38	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q5HCN1	3.39e-30	48	332	38	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	3.39e-30	48	332	38	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999901	0.000127	0.000001	0.000001	0.000000	0.000008

TMHMM  Annotations     

start	end
15	37
337	356
361	383
388	410
420	439