CAZyme Information: MGYG000004451_00729

Basic Information

• Species: CAG-313 sp003539625
• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-313; CAG-313; CAG-313 sp003539625
• CAZyme ID: MGYG000004451_00729
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	MGYG000004451_3|CGC2	49825.88	8.8256

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004451	1583580	MAG	Israel	Asia

• Gene Location: Start: 196823; End: 198127 Strand: -

Full Sequence      

MLSSFLAWIVHTDYTFINVLTWINHILGIIMLVLYANQFVYIVLSIFVKPRRYKVAKTEH
TYGYIICGRNEEKVIGNLIDSILKQDYPKEKMHIFVCADNCTDNTAKVAREAGAIVFERE
NHIQVGKSYALNYTLDKIKNEYSELGIEAYILFDADNLVGKDFTKEMNKAYDQGYKVLAG
FRDSKNFDDSWVSAGSSYMFYRECCQVHKVRSFFNTGSYVSGTGFLVDKSLVENGWNYHT
LTEDIEFSADCAYKGIKIGYVYDAVFFDEQPTKLGDSIKQRLRWCKGNNQVFGRFGGKLL
GGMFKRFTFQKWSMFTHTIPVPAISTIWICIFQLVGGIYCLANHLPSDIYIKIILSAGLS
TIFAPFVSCFIDAILLLIQTYKRTSGNFFKRFLYACGFVIFIAVYIPITVVALFKKNVTW
KQIPHKDTRTIEKI

Enzyme Prediction     

No EC number prediction in MGYG000004451_00729.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	65	285	4.4e-26	0.9608695652173913

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	2.81e-66	65	247	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	1.48e-30	26	413	17	411	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	9.59e-30	65	244	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	1.59e-24	65	284	7	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06439	CESA_like_1	6.53e-19	39	291	7	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO18464.1	1.04e-102	24	434	8	413
AYH41686.1	9.13e-97	34	432	8	409
QNM06492.1	2.06e-96	24	434	9	416
ALC91485.1	3.61e-94	13	434	4	428
AUO18463.1	8.91e-92	23	434	7	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	1.72e-07	57	179	10	127	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	5.09e-12	65	420	54	408	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	4.00e-08	65	292	113	340	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q5HCN1	8.14e-08	64	294	51	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	8.14e-08	64	294	51	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	8.14e-08	64	294	51	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
26	48
312	334
349	371
392	414