CAZyme Information: MGYG000004886_00200

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia
• CAZyme ID: MGYG000004886_00200
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		34675.63	6.7314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004886	1517427	MAG	China	Asia

• Gene Location: Start: 1161; End: 2111 Strand: -

Full Sequence      

MMHFTSRNPAVSAVIATNGKRPELLRVAVRSILEQSYRGFVEVVVVFDRVEPDRLEDIEV
GENRALKIVSTTRSGGLAGGRNSGILASTGAMIGFCDDDDYWMPSKLTQQVALWRENPEA
AAISSGITVRSGGQDIVRLAPERATFADFLRSRITEIHPSAMLYSREDLLGVDGAPARIG
LVDEELPAAYGEDYDLLLRATRHGDVLSVPEPLILVLWDRPSFFSGKWQSMVDGLSYILR
KFPEFEQDPKGLACIAGQIAYAQASLGNNKEARAYARAALRRDPKQLRAWAAYVVSTGVI
KPATLLDLVQKTGRGL

Enzyme Prediction     

No EC number prediction in MGYG000004886_00200.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	14	168	1.7e-16	0.9529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	3.69e-10	12	169	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.83e-09	14	125	3	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	6.59e-09	82	213	68	190	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.40e-07	8	204	2	206	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04195	GT2_AmsE_like	5.54e-06	18	216	8	200	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAS19609.1	5.16e-220	1	316	1	316
ATF62775.1	7.33e-220	1	316	1	316
QXW98950.1	2.10e-219	1	316	1	316
BAI65390.1	2.10e-219	1	316	1	316
QKI08771.1	2.01e-165	2	316	1	310

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004886_00200.