CAZyme Information: MGYG000004886_00174

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia
• CAZyme ID: MGYG000004886_00174
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273		30697.9	6.9087

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004886	1517427	MAG	China	Asia

• Gene Location: Start: 2370; End: 3191 Strand: +

Full Sequence      

MAKILKYVLGLDGANRFDSFYSAGAPAQGFIRYSAVDNRDNHVADEEFDVEFFRSRWHRD
PSPAEKGCMLSHVNMWRDFVASDADWALIAEDDILLSPDAEAVVNAIITKYPQVHLVNLS
DSFANDAGKLNPHVEYIRLSLLSPFVHGKYRMGKPYGTWPLICTGLYLISRSGAELLLKQ
FEDKVPGTVADDYKLYQQWGVDVRFVQPGLCGWEGSSVILESGKRHLDKVNSLQHGTGPL
DRLRIALAPKKRITNAKNALEATLDEVKQRFSR

Enzyme Prediction     

No EC number prediction in MGYG000004886_00174.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	7	181	1.7e-22	0.9116022099447514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3306	COG3306	8.09e-20	7	250	6	243	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
cd06532	Glyco_transf_25	1.34e-17	30	99	28	98	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
pfam01755	Glyco_transf_25	6.08e-12	30	193	30	198	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAI65432.1	6.69e-199	1	273	1	273
ATF62809.1	1.11e-197	1	273	1	273
QXW98985.1	1.11e-197	1	273	1	273
BAS19648.1	5.48e-162	1	273	1	273
ATF62810.1	3.91e-136	1	273	1	273

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004886_00174.