CAZyme Information: MGYG000001094_00042

Basic Information

• Species: Azonexus sp900549295
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Rhodocyclaceae; Azonexus; Azonexus sp900549295
• CAZyme ID: MGYG000001094_00042
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000001094_5|CGC2	37397.57	8.3193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001094	3284523	MAG	Sweden	Europe

• Gene Location: Start: 22991; End: 24049 Strand: -

Full Sequence      

MSKTILIMAGGTGGHIFPALAVAHELRAAGWRVVWLGNPDGMEARLVPQHDLEMVWVRFA
ALRGKGLLRKLMLPFNLLRAFWQARQALQQVQPDVVLGMGGYITFPGGVMARLMGIPLVL
HEQNSVAGLANRVLARIATRVATGFPDVLPAGEWLGNPVRPEIAGLAAPAERFAGRDGAL
RLLVIGGSLGAQALNERVPKGMAELASGQLPQIVHQAGEKHIAALEAAYAEAGVSAHCVP
FIEDMAGAYAWADLVICRAGALTVAELAAAGVASILVPFPHAVDDHQTGNARFLVNVGGA
FLLPQNELTPHSIALMRNYSRSQLLEMAEKARGLAKPDATRDVAQLCSEVAR

Enzyme Prediction     

No EC number prediction in MGYG000001094_00042.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	182	339	1.8e-50	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	8.61e-173	2	352	1	356	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	9.81e-143	5	346	2	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	4.95e-136	3	347	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	3.17e-132	3	352	1	356	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	7.60e-43	182	339	2	162	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM20682.1	1.82e-199	1	352	1	352
AXS80833.1	7.41e-199	1	351	1	351
QRJ63729.1	1.46e-181	2	352	8	358
AEV24657.1	3.56e-179	3	351	4	352
CAB1370239.1	3.33e-175	3	352	2	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	2.06e-111	3	352	7	355	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	3.46e-110	1	352	1	356	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	1.76e-102	3	350	10	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q47AA4	1.71e-205	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Dechloromonas aromatica (strain RCB) OX=159087 GN=murG PE=3 SV=1
A1K3U6	1.13e-162	3	351	2	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Azoarcus sp. (strain BH72) OX=418699 GN=murG PE=3 SV=1
Q5P6Z6	6.37e-160	3	351	2	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=murG PE=3 SV=1
Q1LIM6	5.50e-156	2	351	3	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=murG PE=3 SV=1
Q0K6M4	1.82e-154	3	352	5	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001094_00042.