CAZyme Information: MGYG000001589_00447

Basic Information

• Species: Pyramidobacter piscolens
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Dethiosulfovibrionaceae; Pyramidobacter; Pyramidobacter piscolens
• CAZyme ID: MGYG000001589_00447
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	MGYG000001589_3|CGC2	37364.65	8.9501

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001589	2462654	MAG	China	Asia

• Gene Location: Start: 132204; End: 133241 Strand: +

Full Sequence      

MAYRILLAAGGTGGHIIPSVAFGLWLQKQGESVIWLSGSRPLEDEIYKAHGIAPQKLSLE
GSPLGVPGLRSLKRWKHLFGSFFEACAILKRERIDHCVLFGGYLSMPVLLAARCLHVPAL
IHEQNTVAGKVTRFAARCGIPVACAWEECQGLDTIKKTVTGMPLREIRLIDKKDAQKRLL
GASLSDNEKLIVILGGSLGSGGMKKVLQDAQNMIKSTSYKVLCMGIEPKDRPFPEALTHE
ACWDMTAVFSAADVIVCRAGASTLAELRALGIPALVVPWLKAAGQHQVSNAQYFSKLTGA
PVFLEGSSQEQFRAALQSVAERRMSCENLNAGAVNLYEALRSLTV

Enzyme Prediction     

No EC number prediction in MGYG000001589_00447.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	191	331	1.2e-24	0.9235668789808917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03785	GT28_MurG	1.10e-62	4	331	1	330	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	4.15e-57	4	333	3	335	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	6.77e-50	4	305	2	306	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.61e-49	4	345	2	337	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam03033	Glyco_transf_28	2.37e-28	5	137	1	132	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM21517.1	1.22e-74	4	320	6	327
QTX33536.1	1.36e-71	4	306	5	310
QVL37391.1	1.36e-71	4	306	5	310
ADE56952.1	1.67e-67	4	298	3	301
ACZ19105.1	4.98e-67	4	343	5	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	4.60e-36	1	333	1	332	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	6.51e-33	4	302	11	315	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	2.17e-28	4	320	8	316	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3K744	1.95e-38	1	296	1	296	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=murG PE=3 SV=1
A4XQS4	5.30e-38	1	330	1	328	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=murG PE=3 SV=1
A4VIH8	5.30e-38	1	331	1	329	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=murG PE=3 SV=1
Q604V7	9.91e-38	1	343	1	344	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=murG PE=3 SV=1
Q4K6J3	1.03e-37	1	296	1	296	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001589_00447.