CAZyme Information: MGYG000002127_00600

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; Agathobaculum
• CAZyme ID: MGYG000002127_00600
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		39646.02	7.3313

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002127	1040318	MAG	Mongolia	Asia

• Gene Location: Start: 65; End: 1126 Strand: +

Full Sequence      

MLESKGAEVHTLDVYAYISNLIKTTIDKGYLFSSKHMQTLYRLVYQLAENNGAGYFNSAP
SIINIINALGASKFAKVIANHMPDVIICTHVFAAQMDDELKKRKKLADIETIGIVTDYTL
HPYWEDVPRVQYIVTASELLTYRCIQRGIPESRILPFGIPVHPKFNQKLSREDAAAQLGI
DPRLPTILLMGGSMGHADHVKTIEKLTQIGKPFQLLVVCGNNQKMLYHVEQYAARYQGNC
IIHPYGFVHNVEVMMSASDCIVSKPGGLTVSEALAKNLPMLLVDPIPGHEERNVDFLVNN
GMAALITKHFPIDEAVYELFCNPVRLETVRRTMNEIAHPDATERLAEFVLRKR

Enzyme Prediction     

No EC number prediction in MGYG000002127_00600.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	186	341	3.5e-31	0.9936305732484076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	7.57e-76	8	347	31	356	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PLN02605	PLN02605	4.20e-48	8	352	32	382	monogalactosyldiacylglycerol synthase
PRK13609	PRK13609	1.56e-47	2	350	29	366	diacylglycerol glucosyltransferase; Provisional
COG0707	MurG	1.98e-39	25	351	55	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK13608	PRK13608	3.24e-32	22	345	52	361	diacylglycerol glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU27709.1	2.66e-111	2	350	25	367
AYF42976.1	2.66e-111	2	350	25	367
AYF40136.1	2.66e-111	2	350	25	367
AVQ97480.1	2.66e-111	2	350	25	367
QCN93734.1	2.66e-111	2	350	25	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	4.38e-27	26	341	57	372	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FED1	1.58e-34	3	350	30	366	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=ugtP PE=3 SV=1
Q65IA4	8.18e-34	13	343	41	359	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ugtP PE=3 SV=1
P54166	1.55e-33	13	352	41	368	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ugtP PE=1 SV=1
Q69QJ7	1.18e-29	55	341	213	510	Probable monogalactosyldiacylglycerol synthase 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=MGD1 PE=2 SV=1
P93115	1.50e-29	26	341	187	502	Monogalactosyldiacylglycerol synthase, chloroplastic OS=Cucumis sativus OX=3659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999948	0.000102	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002127_00600.