CAZyme Information: MGYG000003491_00299

Basic Information

• Species: UBA2804 sp900768635
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; UBA2804; UBA2804 sp900768635
• CAZyme ID: MGYG000003491_00299
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000003491_34|CGC2	38604.69	7.8527

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003491	2438052	MAG	Fiji	Oceania

• Gene Location: Start: 20043; End: 21110 Strand: -

Full Sequence      

MTKKLLVMAGGTGGHVFPGLAVAEYLQDRGWKILWLGTRERMESHLVPKYGFDIAYIKVS
GVRRNGLIRKMSSPFMVTRAVIQARKIIKDFKPDVVLGMGGYASGPGGMAAWLSGIPLVL
HEQNAAAGLTNRILSHFAKRICLGFRGAFTGDNVEVVGNPIRREIAALDDFPLENIEDRP
VRILVVGGSLGAQVFNERLPGAFARLSNIEVRHQTGRGNLEAVASRYTGLGATYAQAQEF
IDDMADAYIWADIVICRAGALTVSEIAAAHKVAVFVPLPSAVDDHQTKNAMSLVKSEAAI
LLPQSNFTEDEIVRVLRDLTENPDKITAMAKRVKELAILDATEKVAGICEQLIDD

Enzyme Prediction     

No EC number prediction in MGYG000003491_00299.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	183	340	7.9e-50	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	4.26e-171	3	353	2	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.20e-148	4	346	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	9.10e-139	3	349	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	1.31e-134	3	353	1	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	1.53e-47	3	338	2	342	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSO21682.1	8.14e-136	1	352	1	352
BCM73865.1	8.14e-136	1	352	1	352
QLL79232.1	1.15e-135	1	352	1	352
BCR30727.1	1.15e-135	1	352	1	352
AXB01018.1	1.15e-135	1	352	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	9.77e-108	3	347	7	348	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	7.51e-97	1	349	1	351	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	2.00e-91	3	352	10	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SI56	3.07e-133	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=murG PE=3 SV=1
C4LA25	1.16e-131	1	353	1	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=murG PE=3 SV=1
A0KPX2	1.43e-131	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=murG PE=3 SV=1
A8FQA0	4.66e-131	3	352	8	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=murG PE=3 SV=1
Q9F1N0	4.66e-131	3	352	8	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12) OX=637905 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003491_00299.