CAZyme Information: MGYG000003735_00126

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; QFNR01
• CAZyme ID: MGYG000003735_00126
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000003735_6|CGC1	37962.64	9.4047

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003735	2323542	MAG	Canada	North America

• Gene Location: Start: 20811; End: 21905 Strand: -

Full Sequence      

MGQDNGEAKTARGSWVIMAGGTGGHIFPALAVAKALRERGCAVSWLGSAGSMEEKIAPEN
GFAIHSIHIKGVRRNGWARKLSAPFAVARATFEAARALRREGADGAIGFGGFVTFPGALA
AKLLGKKVVCCEQNAVPGLANRLAGRFADVRLCAYPDAWGGAEAVGNPARAEFFELPSAQ
ERFAGRSGPLRLLVVGGSQGAQRINETLPKALAALSPERRPEVFHQCGKGKMESTEKLYA
QLGVEAQCVEFIDKMAERFAWADFAVCRGGSGTLFELAGAGLGAFVVPLPTAVDDHQTKN
AASFCKAGAARIMAQGPGDAERWAGMIGSLDRGQCLAMAIAAKSLAKPDAAATVALRAEA
LLGR

Enzyme Prediction     

No EC number prediction in MGYG000003735_00126.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	192	350	9.2e-44	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	2.41e-136	16	364	5	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	4.94e-124	16	355	3	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	7.02e-111	16	361	4	354	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	5.12e-109	16	355	4	345	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	4.56e-35	192	354	2	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMT48034.1	3.98e-111	14	363	4	354
QED91463.1	3.07e-108	14	363	5	355
SNW07245.1	3.07e-108	14	363	5	355
ASP18024.1	4.35e-108	14	355	5	347
AZR59298.1	8.73e-108	14	363	5	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	5.70e-79	16	350	13	354	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	8.05e-79	12	354	2	347	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	7.77e-76	16	355	10	347	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9M2H3	1.16e-103	14	355	5	347	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=murG PE=3 SV=1
A1KVL3	9.33e-103	14	355	5	347	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) OX=272831 GN=murG PE=3 SV=1
Q5F6L8	1.87e-102	14	355	5	347	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=murG PE=3 SV=1
B4RQC5	1.87e-102	14	355	5	347	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Neisseria gonorrhoeae (strain NCCP11945) OX=521006 GN=murG PE=3 SV=1
Q9K0Y2	7.52e-102	14	355	5	347	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	32