CAZyme Information: MGYG000004835_00795

Basic Information

• Species: Eggerthella sp014287365
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Eggerthella; Eggerthella sp014287365
• CAZyme ID: MGYG000004835_00795
• CAZy Family: GT28
• CAZyme Description: Argininosuccinate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580		62267.76	4.6125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004835	2601418	MAG	China	Asia

• Gene Location: Start: 2585; End: 4327 Strand: +

Full Sequence      

MALWSGRFTENVSEFTQRFGASLPVDQALYAQDIAGSQAHARMLAKAGVIEPADAAAIVD
GLDRVKARIEAGDFAFDINDEDIHMSVERALIADIGDAGARLHTGRSRNDQVATDTRLFA
KQRCSDLMAANVALRSALVAQAEAHFDVILPGYTHMQHAQPVLFSHHMLAYVWMLTRDFE
RLAAARTAADASPLGSAALAGTTYPLDRQMTAAELGFSTVIPNSLDAVSDRDFLLDLSYA
CSVSCMHLSRLCEEIVLWSSSEFAFIELSDAFSTGSSIMPQKKNPDFAELIRGKTGRVVG
DLVALLVTMKALPLAYNKDLQEDKEGAIDAAKTLEDCLVCAAGMIETMRVVPEAMMAQAK
KGYLAATDVADYLAKKGMPFRRAHEVVGHLVLVCEQRGCDLDDLTLADFKAESDLFEEDI
TASLDVASIVAARTTEGGTGHAAVRAQLALAPEQEERWQLLGYTDHMGDAMAAADVVVSR
AGATSLAEISARALPALLVPFPFATEDHQTMNAQACVEAGAAYLVADADVEGPAFAQKLR
ELIEDEGLRARMAAAARAQKTRDAAGLLADAVMEAARAQR

Enzyme Prediction     

No EC number prediction in MGYG000004835_00795.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	445	564	2.5e-35	0.7197452229299363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0165	ArgH	0.0	1	449	3	451	Argininosuccinate lyase [Amino acid transport and metabolism].
PRK00855	PRK00855	0.0	1	451	4	454	argininosuccinate lyase; Provisional
cd01359	Argininosuccinate_lyase	0.0	22	451	1	431	Argininosuccinate lyase (argininosuccinase, ASAL). This group contains ASAL and related proteins. It is a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASAL is a cytosolic enzyme which catalyzes the reversible breakdown of argininosuccinate to arginine and fumarate during arginine biosynthesis. In ureotelic species ASAL also catalyzes a reaction involved in the production of urea. Included in this group are the major soluble avian eye lens proteins from duck, delta 1 and delta 2 crystallin. Of these two isoforms only delta 2 has retained ASAL activity. These crystallins may have evolved by, gene recruitment of ASAL followed by gene duplication. In humans, mutations in ASAL result in the autosomal recessive disorder argininosuccinic aciduria.
PLN02646	PLN02646	0.0	3	449	18	464	argininosuccinate lyase
TIGR00838	argH	0.0	3	456	1	455	argininosuccinate lyase. This model describes argininosuccinate lyase, but may include examples of avian delta crystallins, in which argininosuccinate lyase activity may or may not be present and the biological role is to provide the optically clear cellular protein of the eye lens. [Amino acid biosynthesis, Glutamate family]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS67217.1	1.48e-74	443	580	230	367
ACV56058.1	7.12e-71	443	580	230	367
BAK44146.1	4.16e-55	443	575	230	362
QTU84759.1	2.39e-47	442	577	229	364
QKF07923.1	9.44e-39	444	576	231	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2E9F_A	2.21e-136	4	454	6	458	CrystalStructure of T.th.HB8 Argininosuccinate lyase complexed with L-Arginine [Thermus thermophilus HB8],2E9F_B Crystal Structure of T.th.HB8 Argininosuccinate lyase complexed with L-Arginine [Thermus thermophilus HB8],2E9F_C Crystal Structure of T.th.HB8 Argininosuccinate lyase complexed with L-Arginine [Thermus thermophilus HB8],2E9F_D Crystal Structure of T.th.HB8 Argininosuccinate lyase complexed with L-Arginine [Thermus thermophilus HB8]
1TJ7_A	7.93e-124	1	451	1	452	Structuredetermination and refinement at 2.44 A resolution of Argininosuccinate lyase from E. coli [Escherichia coli],1TJ7_B Structure determination and refinement at 2.44 A resolution of Argininosuccinate lyase from E. coli [Escherichia coli]
1AOS_A	5.58e-120	3	448	8	452	HumanArgininosuccinate Lyase [Homo sapiens],1AOS_B Human Argininosuccinate Lyase [Homo sapiens]
1K62_A	2.22e-119	3	448	8	452	ChainA, Argininosuccinate Lyase [Homo sapiens],1K62_B Chain B, Argininosuccinate Lyase [Homo sapiens]
1K7W_A	7.02e-116	3	448	10	454	ChainA, delta 2 crystallin [Anas platyrhynchos],1K7W_B Chain B, delta 2 crystallin [Anas platyrhynchos],1K7W_C Chain C, delta 2 crystallin [Anas platyrhynchos],1K7W_D Chain D, delta 2 crystallin [Anas platyrhynchos]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4IRS2	3.38e-164	3	454	4	455	Argininosuccinate lyase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=argH PE=3 SV=1
Q67S72	1.46e-163	3	453	4	454	Argininosuccinate lyase OS=Symbiobacterium thermophilum (strain T / IAM 14863) OX=292459 GN=argH PE=3 SV=1
Q5KW95	1.55e-162	3	453	4	454	Argininosuccinate lyase OS=Geobacillus kaustophilus (strain HTA426) OX=235909 GN=argH PE=3 SV=2
Q8GDU5	8.55e-162	3	454	5	456	Argininosuccinate lyase (Fragment) OS=Heliobacterium mobile OX=28064 PE=3 SV=1
Q9K821	5.56e-160	3	451	4	452	Argininosuccinate lyase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=argH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004835_00795.