CAZyme Information: MGYG000002385_00140

Basic Information

• Species: Leminorella richardii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Leminorella; Leminorella richardii
• CAZyme ID: MGYG000002385_00140
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	MGYG000002385_1|CGC2	47802.6	9.7886

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002385	3976274	Isolate	not provided	not provided

• Gene Location: Start: 155577; End: 156854 Strand: -

Full Sequence      

MLRLIYSFLLYLLQPFIWLRLFLRGRKAPQYRKRWAERYGFCRGKVQPDGIMLHSVSVGE
TLTAIPLVRALRYRYPTLPITVTTMTPTGSERVLSAFGDDVHHVYLPYDLPGSVNRFLNQ
VRPKLVIVMETELWPNLIHQLHRRQVPLVIANARLSARSANGYLKLGKTVRDMMHKITLI
AAQNQEDGERFIQLGLKRSQLAITGSLKFDISVTPELSSRALSLRRQWAPHRPVWIATST
HDGEEQIILNAHRALLERFPDLLLILVPRHPERFSVAEQLTASAGLKFVTRSSGVVPSEQ
DQVIIGDTMGELMLLYGVADFAFVGGSLVERGGHNPLEPAAHGLPVIVGPHTFNFKDICS
KLQLAEGLIVVSNAEELVEAAERLLNDEACRRSYGQNAANVLMQNQGALEKLLALLEPYL
PTRIH

Enzyme Prediction     

EC	2.4.99.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	33	211	5.1e-73	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1519	KdtA	0.0	2	420	1	419	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
PRK05749	PRK05749	0.0	1	423	1	424	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
pfam04413	Glycos_transf_N	5.56e-87	37	211	2	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
pfam00534	Glycos_transf_1	1.03e-10	243	401	16	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03801	GT4_PimA-like	8.27e-06	67	405	23	351	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQI34338.1	3.79e-309	1	425	1	425
QBH98377.1	2.27e-262	1	425	1	425
VEJ56938.1	1.46e-258	1	425	1	425
AKJ43552.1	2.94e-258	1	425	1	425
AWH88689.1	1.70e-257	1	425	1	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	5.78e-39	42	386	39	345	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	2.47e-30	220	423	29	234	ChainA, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AC77	2.86e-222	1	425	1	425	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
P0AC76	2.86e-222	1	425	1	425	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
P0AC75	2.86e-222	1	425	1	425	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
P44806	4.27e-150	3	424	3	427	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1
Q45374	9.33e-69	5	420	5	427	3-deoxy-D-manno-octulosonic acid transferase OS=Bordetella pertussis OX=520 GN=waaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991320	0.008417	0.000223	0.000016	0.000011	0.000025

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002385_00140.