CAZyme Information: MGYG000000157_00176

Basic Information

• Species: Paraclostridium sordellii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium sordellii
• CAZyme ID: MGYG000000157_00176
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235	MGYG000000157_1|CGC4	27721.46	7.7827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000157	3456733	Isolate	China	Asia

• Gene Location: Start: 172561; End: 173268 Strand: -

Full Sequence      

MAIPKIIHYVWVGGNPKSKDIKRCMRTWKKHLKDYEIIEWNEENFDINSNEFVRQAYEAK
KWAYVSDYIRAYAIYHYGGIYLDTDVLVLDDLEDLLQNKAFVGYENPQYPFTAVFGAEKE
HPLLKSILDYYENLSFEFDVNDQYKNVNTKTVSDILIEDYGCELGNKDQLLRTGIKVYKD
NVLCNPSKDSKTIHIFTGTWLEGQSNFAKNLNRIVRLRLTTKNRAKLYSYYRNSK

Enzyme Prediction     

No EC number prediction in MGYG000000157_00176.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	98	8.6e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.98e-13	2	133	81	216	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.43e-10	22	84	5	75	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	0.001	21	133	65	190	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.004	5	44	1	39	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUN15518.1	2.15e-176	1	235	1	235
QYE97619.1	1.98e-172	1	235	1	235
CED94668.1	1.08e-140	1	235	1	235
ASN61482.1	8.58e-116	3	228	2	227
QAS49963.1	8.58e-116	3	228	2	227

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	3.04e-09	2	138	56	195	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
P38287	9.19e-07	3	133	62	199	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
Q9UT67	2.11e-06	2	132	81	214	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
O14084	2.68e-06	3	124	64	192	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000157_00176.