CAZyme Information: MGYG000000265_00019

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_00019
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	MGYG000000265_1|CGC1	28339.55	6.827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 18671; End: 19399 Strand: -

Full Sequence      

MIPKIIHYCWFGRGKMPELALKCLESWKKHLPDYVIKEWNEDNFDLDAYPYAREAYDNRK
FAFVTDIVRLYALYHEGGIYMDTDVEVLKPLDTFLKYDAVSGFESKTQIPTGLMACREGY
PLFKELLDEYDGIHFKQTDGSLDFTTNVVRITNTCLKYGFVPNNQFQAVNGFTLFPKEYF
CPKSYDDGKIYLTENTVTIHHFAGSWLTPKQKITERAVRMIGYDNFETILHLKKKLFSLF
SK

Enzyme Prediction     

No EC number prediction in MGYG000000265_00019.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	96	3.7e-24	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	3.88e-23	1	130	81	214	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	7.28e-18	17	100	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	6.56e-10	1	128	45	186	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	4.44e-06	5	139	94	245	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.001	4	49	1	41	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT95860.1	8.01e-118	1	223	1	223
BBK91625.1	1.19e-116	1	215	1	215
AST53065.1	1.32e-116	1	223	1	223
QJE27088.1	4.19e-116	1	223	1	223
AZS31711.1	6.34e-102	1	221	1	222

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	1.86e-09	2	127	57	185	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
Q9UT67	1.28e-06	1	131	81	214	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_00019.