CAZyme Information: MGYG000001460_00081

Basic Information

• Species: Romboutsia dakarensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Romboutsia; Romboutsia dakarensis
• CAZyme ID: MGYG000001460_00081
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	MGYG000001460_4|CGC2	29330.73	7.1352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001460	3735762	Isolate	not provided	not provided

• Gene Location: Start: 48284; End: 49018 Strand: +

Full Sequence      

MIPKKIHYVWIGGPKGNLENICINSWREKLPDYEIVEWNEHNIDIEKEIKGNKFLEECYK
RKIWAFISDYIRVKKLYEEGGVYMDTDMQILKDITHLLDKNEVFFGYENDVYVSCGIIGS
VAGHKFFKDMLDFYENEILDADIFTIPKIVTRVLETKYEKINKNLYTDDIYVYDKEYFYP
FYHNEDFEYSCIKENTHGIHWWGKSWLKKRDYFLETKHLRGSNKAIKCSKIFVKNTLISL
KGRK

Enzyme Prediction     

No EC number prediction in MGYG000001460_00081.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	100	1.3e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.12e-35	1	228	81	304	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	9.93e-13	16	104	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.92e-05	21	136	67	190	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.004	4	42	1	39	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI73878.1	7.27e-143	1	244	1	244
AVD37393.1	2.16e-127	1	239	1	240
AVD39157.1	2.16e-127	1	239	1	240
QQY47269.1	2.16e-127	1	239	1	240
AXU91387.1	2.16e-127	1	239	1	240

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5UQW4	2.74e-09	1	219	1	227	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1
Q5ZU30	5.07e-08	2	165	28	218	Subversion of eukaryotic traffic protein A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=setA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001460_00081.