CAZyme Information: MGYG000004685_00134

Basic Information

• Species: CAG-245 sp900758165
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-245; CAG-245 sp900758165
• CAZyme ID: MGYG000004685_00134
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606		71550.21	9.4611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004685	1257965	MAG	China	Asia

• Gene Location: Start: 17148; End: 18968 Strand: +

Full Sequence      

MEKIIHYCWFGDKPLSKLAKKCIKSWKKFLPDYKIIKWTEENVNLNECIFIKEAYANKKW
AFVADYVRTKALNEYGGIYFDTDMEVTKDISDLLESNKTFLGVEDTGYVAVGVWYEREKK
SFLSSELLKRYRSIKKFDINKMADMSIPKIVSEILEPYGLKKGGTKIQLLENDIKIYPRD
YFYPYSFHRDNNVFSENTCMIHYYDASWLPKRDKREMMLVRRFGRDKTNKILNTYRRLKQ
LIIKCLKIPLFPIVLYRHHKAKMIVITDSYLNRLNETINCIEKNKDKEYITIYNKLWLGV
TSATNELFENLVDCNEIYRKKDVKAIGNAILNANIKQLVFSSFALGWEELVKYLRTKNKN
IKIKVFWHGSHSQILDPYGWKRNLEFIHLHQSGYVDAIGTCKESLMNFYKKQGYNAYFIT
NKVSEIKITKEESKIKTDKDKKVIGIYAAKCDDWRKNMYSQMAAVKLIENAVIDMVPLNE
QAKTFAEQYGIEITGVEKPISREKMMQRMAKNDINLYVTFSECAPMLPLESMELGVPCIT
GNNHHYFKNNKLEKYIVINNETDIEEIKRKILECIENKAKIMQYYKQFSEKNIEESKEEV
KQFLNA

Enzyme Prediction     

No EC number prediction in MGYG000004685_00134.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	18	96	3.1e-22	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.36e-19	2	214	83	285	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	4.55e-13	20	94	5	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	4.26e-10	1	95	46	145	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
COG0438	RfaB	7.99e-06	338	599	87	360	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	1.93e-04	472	580	38	147	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAI33206.1	1.39e-53	1	231	2	231
ASO97438.1	5.42e-52	1	231	2	231
AUC46774.1	5.42e-52	1	231	2	231
QCO91874.1	5.42e-52	1	231	2	231
ASO97422.1	5.42e-52	1	231	2	231

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004685_00134.