CAZyme Information: MGYG000000312_00060

Basic Information

• Species: Eisenbergiella sp900539715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900539715
• CAZyme ID: MGYG000000312_00060
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828		95583.94	5.712

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000312	2782709	MAG	Sweden	Europe

• Gene Location: Start: 59843; End: 62329 Strand: -

Full Sequence      

MLKKAPMKFDKELFKGSVINNIKTLYRRTLEEATPQQVFQAVSYAIKDVIVDNWMISQKE
YEKKDPKMVYYMSMEFLMGRALGNNLINLCAYSEVQEALDELGLDLNLIEDQEPDPALGN
GGLGRLAACFLDSLATLNYAAYGCGIRYRYGMFRQEIQNGFQVEVPDNWLADGYPFELRR
PEYAKEVKFGGWVSSYTDENGRTIFKQEGYQSVKAVPYDMPIVGYGNGIVNTLRIWDAEP
VECFSLDSFDKGDYQKAVEQENLARNIVEVLYPNDNHYAGKELRLKQQYFFISASVQEAV
EKYMRTHKDLHKFHEKVAFQLNDTHPTVAVAELMRVLMDDYYLSWEEAWDITTKTCAYTN
HTIMSEALEKWPIELFSRLLPRIYQIVEEINRRFVLQIQQMYPGNQEKIRKMAIIYDGQV
KMAHLAIVGGHSVNGVARLHTEILKNQELKDFYEMMPAKFNNKTNGITQRRFLLHANPLL
ADWVTDHVGDEWITDLPAISKLRIYADDEKAQQEFMNIKYRNKVRLAKYIREHNGIEIDP
RSIFDVQVKRLHEYKRQLMNILHIMYLYNQIKDHPDMEFYPRTFIFGAKAAAGYRNAKLT
IKLINNVADVINNDPVVNGRIKVVFIENYRVSNAEWIFAAADVSEQISTASKEASGTGNM
KFMLNGALTLGTMDGANVEIVEEVGKENAFIFGLSADQVIQYENFGGYNPMDIFNNDQDI
RRVLMQLINGTYSANDTELFRPLYNSLLNTQSTSKADTYFILADFKAYAEAQRRVEEAYR
DEKNWAKSAILNVASAGKFSSDRTIEEYVNDIWHLDKVILPQKLEKTK

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	98	815	6.6e-282	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	33	820	36	815	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	10	817	5	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	8	813	4	794	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	18	815	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	15	815	1	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02962.1	0.0	9	820	17	833
QBE95906.1	0.0	9	820	6	818
QIB55899.1	0.0	9	820	6	818
QMW76233.1	0.0	9	820	6	818
ASM70669.1	0.0	9	820	6	818

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OX0_A	1.04e-276	33	816	47	829	GlycogenPhosphorylase in complex with CK898 [Oryctolagus cuniculus]
2GJ4_A	1.09e-276	33	816	35	817	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2GM9_A	1.13e-276	33	816	35	817	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
7O8E_A	1.34e-276	33	816	40	822	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
1ABB_A	1.77e-276	33	816	37	819	ControlOf Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate [Oryctolagus cuniculus],1ABB_B Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate [Oryctolagus cuniculus],1ABB_C Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate [Oryctolagus cuniculus],1ABB_D Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P73511	2.04e-280	12	820	27	831	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1
P79334	1.20e-277	33	816	47	829	Glycogen phosphorylase, muscle form OS=Bos taurus OX=9913 GN=PYGM PE=1 SV=3
O18751	3.40e-277	33	816	47	829	Glycogen phosphorylase, muscle form OS=Ovis aries OX=9940 GN=PYGM PE=2 SV=3
P00489	1.14e-275	33	816	47	829	Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus OX=9986 GN=PYGM PE=1 SV=3
Q9WUB3	6.30e-275	33	816	47	829	Glycogen phosphorylase, muscle form OS=Mus musculus OX=10090 GN=Pygm PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000312_00060.