CAZyme Information: MGYG000000663_00360

Basic Information

• Species: UMGS1668 sp900768105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1668; UMGS1668 sp900768105
• CAZyme ID: MGYG000000663_00360
• CAZy Family: GT35
• CAZyme Description: Maltodextrin phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790		89779.71	5.9538

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000663	1768787	MAG	Kazakhstan	Asia

• Gene Location: Start: 46376; End: 48748 Strand: +

Full Sequence      

MQSVDFCRTKIIEVLRDDFNETPETAELSHIYAAAATVVRRLLVQRRSKQTYHGEKRVYY
LSMEFLMGRSLRNDLYNLGIKDAFEAALASLGVSPEKIYEQEPDAGLGNGGLGRLAACFL
DGLATIGRPAMGYSICYEYGIFRQKLCEGWQTEKPDDWLPGGKVWLSEQAEKAVEVNFGG
EIEESWHDGFHHVVMKNCETVKAVPYDILVPGFGAENVSKLRLWRAESPLPDMDLFNRGL
YPEAFRKAAMARAISSILYPNDSHPEGKLLRLKQQYFLCCATIQDIVHRHLAKYGTLENL
PEKAAIHINDTHPTLAIPELMRVLLDECGFTWENAEEICRRLFSYTNHTVLPEALERWDS
FMFSALLPRIFTIVKELDRREREYLSRRGFSAEETERMAIISGSQIHMANLCVYCCHSVN
GVSAHHVKVMETSVFSTLYKAFPERFCGITNGIAARRWLCCANPELTAFVKKYAGDDFEH
DYKKMSMLKKHADDYAVLSELSSVKRLRKEIFAAQNFDVCGKLLDPSSIFDVQAKRLHEY
KRQHLNAMRIIALMNRIDANPNADIYPRTFIFGAKAAPGYYIAKRIIKLIWCIGKELSEN
PNYSDRLRLCFLENYSVTASELLMPAADISEQISLAGTEASGTGNMKLMLGGAVTVGTLD
GANIEILDAVGEENFMRFGMSTDEVRALQQRGYSPYDFISSDGELRAVLDRMRRGIGGED
FSDLANMIAGDDRYMAAADFRSYMNIQDEADRLYRDEQRWFKMSLMNIAAAPEFFVDRTV
EEYCEKIWGM

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	87	789	3e-240	0.9955489614243324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	34	790	44	810	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	11	789	13	747	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	33	788	37	794	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	11	789	1	793	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	8	789	1	794	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL18319.1	2.64e-295	5	790	8	798
CBK97235.1	2.37e-291	10	790	13	798
CBL33913.1	4.76e-291	10	790	13	798
CCO06148.1	1.02e-288	8	790	16	801
ADU21019.1	3.58e-286	8	790	15	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GJ4_A	1.64e-217	32	790	41	816	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2GM9_A	1.69e-217	32	790	41	816	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
2FFR_A	1.69e-217	32	790	41	816	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
7O8E_A	1.98e-217	32	790	46	821	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
1C8L_A	2.91e-217	32	790	52	827	SynergisticInhibition Of Glycogen Phosphorylase A By A Potential Antidiabetic Drug And Caffeine [Oryctolagus cuniculus],1LWN_A Crystal structure of rabbit muscle glycogen phosphorylase a in complex with a potential hypoglycaemic drug at 2.0 A resolution [Oryctolagus cuniculus],1LWO_A Crystal structure of rabbit muscle glycogen phosphorylase a in complex with a potential hypoglycaemic drug at 2.0 A resolution [Oryctolagus cuniculus],2GPA_A Allosteric Inhibition Of Glycogen Phosphorylase A By A Potential Antidiabetic Drug [Oryctolagus cuniculus],3AMV_A Allosteric Inhibition Of Glycogen Phosphorylase A By A Potential Antidiabetic Drug [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9XTL9	1.44e-223	28	790	49	828	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2
Q8CI94	6.44e-219	32	790	53	828	Glycogen phosphorylase, brain form OS=Mus musculus OX=10090 GN=Pygb PE=1 SV=3
P53534	4.39e-218	32	790	53	828	Glycogen phosphorylase, brain form (Fragment) OS=Rattus norvegicus OX=10116 GN=Pygb PE=1 SV=3
Q5MIB6	1.45e-217	32	789	53	827	Glycogen phosphorylase, brain form OS=Ovis aries OX=9940 GN=PYGB PE=2 SV=3
Q9WUB3	1.99e-217	32	790	53	828	Glycogen phosphorylase, muscle form OS=Mus musculus OX=10090 GN=Pygm PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000663_00360.