CAZyme Information: MGYG000001183_00595

Basic Information

• Species: UMGS1441 sp900551755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274; UMGS1441; UMGS1441 sp900551755
• CAZyme ID: MGYG000001183_00595
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816		93610.98	5.5455

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001183	2128086	MAG	Austria	Europe

• Gene Location: Start: 70095; End: 72545 Strand: +

Full Sequence      

MHINKEEFKKKLAANVKTLSRKTIETATKEQLYEALVFTIRDYVTDKWLKTHETYDKTGC
KIVCYLSMEFLMGRFLGNAILNMTMLNDVKSVLKEMNIDYNLLEDVERDPGLGNGGLGRL
AACFLDSLSTLELPAYGCGIRYHYGIFEQRIENGYQIEVPDNWLQDGDMWGVKRPEYAVE
VKFGGNVKAVKQEDGQYKFEQENYQSVIAVPYDYPVIGYNNNTVNTLRLWDAEAKNKFDL
KSFNEGNYSKAVEEENLAKTLTEVLYPADEHYAGKELRLRQQYFFVSATLQRIMNKFVQK
FGTDFSLLPEKYAFQLNDTHPSIAVAELMRLLVDEHNVAWDDAWEITKKCCAYTNHTIMS
EALEKWPIELFSRLLPRIYMIVEEINRRFCEMLINKYGNNADKIRKMAIVADGQIRMAWL
AIVGSHSVNGVAALHTEILKNQELKDFYEIYPEKFNNKTNGITQRRWLGHANPELASLIT
EKIGDGFYTNLSELEKLVPLADDKDFQKKFMAIKKANKVALSDYFKATMGIEINPDSIYD
IQVKRLHEYKRQLLNILHVMSLYNKLKVNPGMDMVPRTFIFGAKSAAGYRRAKLIIKLIN
SVADLVNNDETIEGKIKVIFAENYRVSLAEKLIPAADVSEQISTASKEASGTGNMKFMLN
GALTMGTLDGANVEIREEVGDDNIFIFGMKADEVIAEYSKNDYNPWDIYNMNSDVRGVLN
MLINGTLDKDTELFREIYDSLLNGYNGARPDEYFVLKDFASYAEAQDRVDKAYRDKDKWA
KMAILNTAHSGKFSSDRTIQEYADDIWNLKPVHIEM

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	93	809	4.6e-288	0.9955489614243324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	27	814	36	815	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	2	811	3	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	63	810	61	797	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	15	809	4	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	9	809	1	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMJ42419.1	0.0	3	815	6	816
QUH29011.1	0.0	1	816	4	818
QUI25590.1	0.0	6	816	9	818
VDN48220.1	0.0	1	816	4	818
ASM70669.1	0.0	2	814	5	818

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5IKO_A	2.45e-275	27	816	50	838	Crystalstructure of human brain glycogen phosphorylase [Homo sapiens],5IKP_A Crystal structure of human brain glycogen phosphorylase bound to AMP [Homo sapiens]
5OX0_A	5.07e-274	4	811	24	830	GlycogenPhosphorylase in complex with CK898 [Oryctolagus cuniculus]
2GJ4_A	7.54e-274	4	811	12	818	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2FFR_A	7.80e-274	4	811	12	818	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
2GM9_A	7.80e-274	4	811	12	818	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P73511	2.60e-293	6	816	27	833	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1
P39123	4.90e-278	1	812	1	797	Glycogen phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgP PE=2 SV=1
Q3B7M9	1.50e-275	27	811	47	830	Glycogen phosphorylase, brain form OS=Bos taurus OX=9913 GN=PYGB PE=2 SV=3
P79334	2.90e-275	4	816	24	835	Glycogen phosphorylase, muscle form OS=Bos taurus OX=9913 GN=PYGM PE=1 SV=3
Q8CI94	8.54e-275	27	816	47	835	Glycogen phosphorylase, brain form OS=Mus musculus OX=10090 GN=Pygb PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001183_00595.