CAZyme Information: MGYG000002127_00547

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; Agathobaculum
• CAZyme ID: MGYG000002127_00547
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
756		85197.4	5.2172

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002127	1040318	MAG	Mongolia	Asia

• Gene Location: Start: 37; End: 2307 Strand: -

Full Sequence      

MPKTQYTKTALKQAIAGKLQRHFACEVADATKDQVYEACALVVRDALTEHMIETQNEVER
DGERQVHYLCMEFLVGRSLRNNAYNLGILDALTAALKDMGFEMADIFEEEADPGLGNGGL
GRLAACYMDGMATDGVRGTGYSIRYEHGIFKQKIVEGQQVELPDSWLATGEVWQIPAMDE
TREVKIGGTVDTYFDDNGKLVVNYHDYTPVLAVPYDMPISGYDTNNIARLRLWKAQSPIA
LDMKLFSSGEYLKALEKHALAETISMVLYPEDNHREGQSLRLKQQYFLVSATLQDICAKH
KVKYGTLENFAHKHVLHINDTHPTLVIPELMRILMDENDMSWEQAWNITSQSVAYTNHTV
MPEALECWPVSLMQELMPRIMQIIYEINERFCKELWNYFPNDFQKISKLAIVADDTVRMA
HLAIAGSFSINGVSALHSEILKERVFTDFYNIYSSKFCNVTNGIAHRRWLCEANPELAEL
IESKIGKGYRTHPSELQVLNNYADDKELLDKLGEIKRHNKQRLADYIKAHNGIEVNMDSI
FDVQVKRLHEYKRQMLNILHIISLYHKLKDNPDMDFVPRTFIFGSKAAPGYAVAKKTIQL
INSISKMIDNDPAVRDKLKVVFLEDYKVSLAEIIMPAAEVSEQISIAGKEASGTGNMKFM
MNGALTIGTMDGANVEICEAVGQENIFIFGMETPEAEALAASGNYEPMVIYQNDPVIRRV
LDQMIHGFGDGVDYTDIANLLLHGGNGGPADPKSPF

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	95	742	2.8e-247	0.9065281899109793

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	10	727	16	730	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	10	729	8	668	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	2	752	1	739	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	27	745	13	735	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	12	745	1	736	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK80927.1	1.28e-303	6	744	3	737
BCK78905.1	2.39e-303	7	751	2	741
ANU40324.1	4.83e-301	5	751	6	751
QQR06906.1	4.83e-301	5	751	6	751
QIA32151.1	6.16e-301	5	751	3	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GJ4_A	2.35e-227	30	743	35	756	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2GM9_A	2.43e-227	30	743	35	756	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
2FFR_A	2.43e-227	30	743	35	756	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
7O8E_A	2.86e-227	30	743	40	761	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
1ABB_A	3.79e-227	30	743	37	758	ControlOf Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate [Oryctolagus cuniculus],1ABB_B Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate [Oryctolagus cuniculus],1ABB_C Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate [Oryctolagus cuniculus],1ABB_D Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39123	1.97e-235	29	742	26	732	Glycogen phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgP PE=2 SV=1
Q9XTL9	2.52e-234	30	742	47	767	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2
P79334	2.78e-230	30	743	47	768	Glycogen phosphorylase, muscle form OS=Bos taurus OX=9913 GN=PYGM PE=1 SV=3
O18751	5.57e-230	30	743	47	768	Glycogen phosphorylase, muscle form OS=Ovis aries OX=9940 GN=PYGM PE=2 SV=3
P73511	1.59e-228	3	742	21	765	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002127_00547.