CAZyme Information: MGYG000002230_00077

Basic Information

• Species: Ruminococcus sp900545125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900545125
• CAZyme ID: MGYG000002230_00077
• CAZy Family: GT35
• CAZyme Description: Maltodextrin phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
802	MGYG000002230_3|CGC1	91061.81	6.2152

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002230	2337720	MAG	United States	North America

• Gene Location: Start: 11311; End: 13719 Strand: +

Full Sequence      

MAIKKANPLMDRIKEEFPRKLQLLYSVSPEEASDKQVYHVLSSIIVEILGAKRQSFINHT
HSVGGKQIYYLSMEFLMGRSLKTSIYNLELADDIRAMLKSYDINLDKIYDHEPDAGLGNG
GLGRLAACYLDGLATQGFPAMGHSICYEYGIFQQKLEDGWQTELPDNWLPGGSVWLVPKP
ELSIDIHFEGDLQEYWDNQYHYISHVNYNTVVATPYDMYVSGYGSEGVSVLRLWSAKAPS
FDMDMFNKGNYESALAQNSIANAISKILYPNDNHNKGKSLRLRQQYFLCAAAVGDIVNTH
MNVYGTLDNLAEKVAIHINDTHPTLAIPELMRILLDDCGYTWEKSWDIVVKTFAYTNHTV
MAEALEKWDVNLVKHVIPRIFSIIVEINNRYCQSLMERNGYDSAKTTRMSIIKDNMIHMA
TLCVAVSHSVNGVSKLHSEIIKQSVFHDEYENTPEKFKNVTNGIAYRRWLYQSNPGLTGL
LEETIGEKFIKDGAELEKFRAFQDDQEVLTKLMDVKKANKDRFAKRVKNTSGIILDTDSI
FDVQVKRLHEYKRQHLNVMNILADYAYLLNNPDAPFTPKTYIFAAKAAPGYYLAKQIIKM
IWAISEEIRKNPRIRQKLQVVFLENYCVTLSEILMPASDVSEQISLAGTEASGTGNMKLM
LNGAVTLGTLDGANIEIKEAAGDDNIVIFGMTTPEVNELKARGYRPEDYFNSNPVIREGI
ERMYHGINGCTFNDVANSLKDRDPYMVLADFDSYRNAQRYVTECYNDKMKWAKMSLNNIA
GAGIFSADRAVTEYADNIWHLR

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	98	801	2.6e-255	0.9955489614243324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	66	802	70	811	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	8	801	4	748	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	19	799	16	794	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	17	801	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	14	801	1	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL18319.1	0.0	13	801	10	798
ADU21019.1	0.0	11	801	12	800
CCO06148.1	0.0	13	801	15	801
CBK97235.1	0.0	11	801	8	798
CBL33913.1	0.0	11	801	8	798

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1Z8D_A	9.93e-230	13	799	28	826	ChainA, Glycogen phosphorylase, muscle form [Homo sapiens]
5OX0_A	1.16e-228	13	799	28	826	GlycogenPhosphorylase in complex with CK898 [Oryctolagus cuniculus]
2GJ4_A	1.78e-228	13	799	16	814	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2GM9_A	1.83e-228	13	799	16	814	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
7O8E_A	2.16e-228	13	799	21	819	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9XTL9	6.00e-237	13	799	28	826	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2
P11217	6.78e-230	13	799	28	826	Glycogen phosphorylase, muscle form OS=Homo sapiens OX=9606 GN=PYGM PE=1 SV=6
Q9WUB3	1.54e-228	10	799	25	826	Glycogen phosphorylase, muscle form OS=Mus musculus OX=10090 GN=Pygm PE=1 SV=3
Q8HXW4	2.18e-228	13	799	28	826	Glycogen phosphorylase, muscle form OS=Macaca fascicularis OX=9541 GN=PYGM PE=2 SV=3
P79334	2.18e-228	13	799	28	826	Glycogen phosphorylase, muscle form OS=Bos taurus OX=9913 GN=PYGM PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002230_00077.