CAZyme Information: MGYG000002858_00250

Basic Information

• Species: Collinsella sp900541725
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900541725
• CAZyme ID: MGYG000002858_00250
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808		91331	4.8232

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002858	2129355	MAG	United States	North America

• Gene Location: Start: 126899; End: 129325 Strand: -

Full Sequence      

MNKIFDNKQEFTELYRDAVMSISGKSVEAASDLDRFNALAKLVAEKARTVATKSDARATA
EGKKRVYYFSIEFLIGRLLDNYLLNFGVRDMVAEALDDMGFDLSVIENQEPDPALGNGGL
GRLAACFLDSMAAEGIAGYGNGMRYRYGLFKQEIVNGSQVEATDEWLTHGYPWEVRRQDK
AVTIKFGGHVEGFEENGRTFYRTVDTQDILAVPYDIPVVGYAGETVNKLRVWAAEPVEEH
FDLEAFNRGDYALADAERAEAEAISAILYPNDAGEHGRLLRLKQEYLFVSAGIYSLLDTF
EKEHGANWELLPQFVAIHTNDTHPAMCGPELMRILIDEKKLEWDDAWNIVTQVVSYTNHT
ILPEALEKWPIGTFSKLLPRVYQIIDEISRRWHESFDTTQEGWQERLRQTAILWDGEIRM
ANLSVICSHSVNGVAKIHSDIIKNIVLKDFYALTPEKFNNKTNGISHRRFFGEANPTYAK
LVTEAIGDGWLKDAFELEKLKGFKDDTEFLKAVGASKRTNKERLAAYVKAETGLVIDPNT
VFDVQVKRFHAYKRQLMNIMKVMDIYNRRIADPNFHVTPTTFIFSGKAASSYTFAKETIR
LINSVADVINNDPRVNEVMKVCFIPNFRVSNAQLIYPAAEISEQISTAGKEASGTSNMKL
MMNGAITLGTLDGANIEIADLAGRENEAVFGLTAPEVEQLWASNSYFAWDTLNGDRERLG
RVMDELKDNTFAGLSGNFESIYNELMNNNDPDLVMADFRSYVDAWEKLTGSYCDQETWNR
KALLNTASSGWFSSDRTIREYRDEIWHA

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	95	807	1.5e-255	0.9955489614243324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	19	807	25	809	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	7	808	5	748	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	38	808	41	796	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	24	807	10	793	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	24	807	13	794	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33256.1	0.0	1	808	1	808
AZH69617.1	0.0	1	808	1	808
ATP53563.1	0.0	1	808	1	808
AEB07178.1	0.0	1	808	1	808
QWT17136.1	0.0	1	808	1	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1Z8D_A	1.31e-220	25	806	42	826	ChainA, Glycogen phosphorylase, muscle form [Homo sapiens]
2GJ4_A	2.94e-220	25	806	30	814	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2GM9_A	3.03e-220	25	806	30	814	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
2FFR_A	3.03e-220	25	806	30	814	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
7O8E_A	3.56e-220	25	806	35	819	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39123	3.40e-250	4	806	1	792	Glycogen phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgP PE=2 SV=1
Q9Z8N1	7.44e-229	25	808	31	814	Glycogen phosphorylase OS=Chlamydia pneumoniae OX=83558 GN=glgP PE=3 SV=1
Q9PKE6	8.80e-222	28	808	30	809	Glycogen phosphorylase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=glgP PE=3 SV=1
Q3B7M9	1.64e-221	25	808	42	828	Glycogen phosphorylase, brain form OS=Bos taurus OX=9913 GN=PYGB PE=2 SV=3
P73511	2.80e-221	66	806	84	824	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000008	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002858_00250.