CAZyme Information: MGYG000003019_00099

Basic Information

• Species: Alistipes sp900553175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900553175
• CAZyme ID: MGYG000003019_00099
• CAZy Family: GT35
• CAZyme Description: Maltodextrin phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801	MGYG000003019_1|CGC4	89295.44	5.2147

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003019	1454145	MAG	China	Asia

• Gene Location: Start: 120784; End: 123189 Strand: -

Full Sequence      

MTNQISRDELRSAIADKLCAHFGVTAGDATDEQVFQAAAIVIREILSRLHTFDSRTAPER
EVHYLSMEFLMGRSLMKDAFNLGIGDALTGALEDLGRSAADIFETEPDAGLGNGGLGRLA
ACYMDSLATEGIPATGYSLCYELGIFRQRIVDGRQTEVADNWRTAASSWLVPCHEDTVEV
RFGGRVEQHWDAYGHYHGELRGYESVLAVPRDMLIAPYGDGRVNTLRLWEAHSPNDLDMY
LFAAGSYVQSLEQRTMAEVITKVLYPADDHMEGKTLRIRQQYFFVSATAQSILRAHRARY
GTVRNFAEHHVIQINDTHPTLIIPELMRLLLDDDGLGWDEAWAIVTACVNYTNHTVMSEA
LETWPQGLIQSQLPRVWEIICEINRRWCDELRARFGDDARVGRNLIIADGSVHMANLCLA
ACKTINGVSALHGEILRRDLFRDVCALDPGRFTYVTNGIDHRRWLAQCNPGLHALVCDVL
GSDRYLLHPEELAGLERAADDPAVLARLEEIKALNKQRLAAWVFRTDGFSLNSDAILDVQ
VKRLHEYKRQLLCAMRITQLQLLLHDDPDQPFQPRTFLFAAKAAPGYAVAKRIIQLLCSL
AADVNADPVCRGRLQVYFLPNYRVSAAEMLMPAAQVSEQISTAGKEASGTGNMKLMMNGA
VTIGTLDGANVEMFEQLGADNMFLFGLHADEAEALRAAGYDPQAYVRRSPWLGRVLERMS
CGYADGESYADLVSSLLYGGDPYLLLADFDDYAATHERLYTTIADPAVRARLSLVNIARS
GIFAADRAVREYAERIWEVHA

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	91	799	5.7e-234	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	5	799	12	810	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	2	801	1	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	21	800	20	797	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	14	799	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	11	799	1	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU40324.1	0.0	3	799	5	809
QQR06906.1	0.0	3	799	5	809
QIA32151.1	0.0	3	799	2	806
QUO35271.1	0.0	6	799	4	801
BCK80927.1	0.0	6	799	4	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7TM7_A	5.18e-211	21	798	29	801	ChainA, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286],7TM7_B Chain B, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286]
2C4M_A	1.44e-208	23	799	22	788	Starchphosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_B Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_C Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_D Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae]
3ZCP_A	6.40e-208	29	799	47	828	Rabbitmuscle glycogen phosphorylase b in complex with N- cyclohexancarbonyl-N-beta-D-glucopyranosyl urea determined at 1.83 A resolution [Oryctolagus cuniculus]
2GJ4_A	7.03e-208	29	799	35	816	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2FFR_A	7.25e-208	29	799	35	816	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9Z8N1	2.64e-213	3	799	10	814	Glycogen phosphorylase OS=Chlamydia pneumoniae OX=83558 GN=glgP PE=3 SV=1
Q9XTL9	1.81e-207	40	799	64	828	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2
P00489	6.99e-207	29	799	47	828	Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus OX=9986 GN=PYGM PE=1 SV=3
P79334	1.35e-206	29	799	47	828	Glycogen phosphorylase, muscle form OS=Bos taurus OX=9913 GN=PYGM PE=1 SV=3
O18751	1.91e-206	29	799	47	828	Glycogen phosphorylase, muscle form OS=Ovis aries OX=9940 GN=PYGM PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003019_00099.