CAZyme Information: MGYG000003729_00108

Basic Information

• Species: Peptostreptococcus sp000758885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptostreptococcus; Peptostreptococcus sp000758885
• CAZyme ID: MGYG000003729_00108
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794	MGYG000003729_3|CGC1	90784.09	5.3379

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003729	1511126	MAG	Canada	North America

• Gene Location: Start: 2372; End: 4756 Strand: -

Full Sequence      

MNHMTKDIEQYLQTKFGNSLGESNERQLYQALMAETRNRLSKKRYDYTKKLKESGQKQAY
YMSMEFLVGRTLRNNLFNLGIEGEVRSFLAEKNFDLDRIYDMEPDPGLGNGGLGRLASCY
LDALTSNDYPVTGFSILYEFGIFKQVIANGWQQEYPDNWLGMGQYGLVHRSDEEIEVRFY
GKTKEHWTNEGLKVSYEDYTSIIAEPYDLMISGYKSEAVNVLRLWKSKANAGFDMKLFER
GEYARSSESEAIAESISKLLYPADDNDKGKALRIKQQYFFTSASLQQIVKNHYKEYGTLD
NLADKAAIHINDTHPSMCIPELMRILMDDYDYSWENAWDITTKVFAYTNHTIMAEALEKW
SVDLFAPILPRIYTIIREINNRFCQYCNEIGAASDLESMSIIHNNMIRMANLCIVGSYNV
NGVSGLHTDILKADTFEPFNRIYPGKFNNVTNGIAHRRWLGQANPELTGYLNGLLGGDFI
KDLSNIEELLKYADDKTVLADLEKIKRTKKEQLAKYIKDANGINVDIDSIFDVQVKRLHE
YKRQLLNALHIVYLYRQIKFNGLKPRPRTFIFAAKASSGYVMAKNIIKFICTLSEMIESD
PELRDYIKVVFLEDYRVTLAEIIIPGANVSEQISQAGKEASGTGNMKLMLNGALTLGTLD
GANVEIHDAVGDENMFLFGLKTPEVNDLYAKGYRPRDYYENVPAIKETLDFMRTINIDGT
GFGNIVDYLINHDPYMCLADFESYVNKQAEVAEAYGDKDRWNKMSLVNIAKAGIFSADRA
TQEYTDGIWHIDRV

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	89	791	2.2e-259	0.9955489614243324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	57	794	70	813	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	7	793	12	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	15	793	20	798	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	8	791	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	6	791	2	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI38823.1	0.0	8	794	10	796
QIX87764.1	0.0	8	794	10	796
QGS08182.1	0.0	8	794	10	796
SQH55554.1	0.0	8	794	10	796
AXI27056.1	0.0	8	794	10	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GJ4_A	2.16e-213	53	792	65	817	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2GM9_A	2.23e-213	53	792	65	817	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
2FFR_A	2.23e-213	53	792	65	817	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
7TM7_A	2.28e-213	55	793	66	804	ChainA, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286],7TM7_B Chain B, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286]
7O8E_A	2.61e-213	53	792	70	822	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P73511	6.03e-225	11	794	39	829	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1
P39123	1.31e-224	12	791	16	794	Glycogen phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgP PE=2 SV=1
P0AC87	5.30e-220	57	794	70	813	Glycogen phosphorylase OS=Shigella flexneri OX=623 GN=glgP PE=3 SV=1
P0AC86	5.30e-220	57	794	70	813	Glycogen phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=glgP PE=3 SV=1
O84250	1.86e-217	57	793	66	811	Glycogen phosphorylase OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003729_00108.