CAZyme Information: MGYG000003803_00087

Basic Information

• Species: Pantoea conspicua
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea conspicua
• CAZyme ID: MGYG000003803_00087
• CAZy Family: GT35
• CAZyme Description: Maltodextrin phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800		89987.93	6.3434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003803	3817683	MAG	Canada	North America

• Gene Location: Start: 14996; End: 17398 Strand: -

Full Sequence      

MTQPEFNPEHFTAALTRQWQRFGLRDARDMTPAQWWQALSGALADLLAAQPAVASDSSLR
HVNYLSMEFLIGRLTGNNLLNLGWYNAVNEALAGWDISLTEVLENETDPALGNGGLGRLA
ACFLDSMATVGQPAIGYGLNYQYGLFRQRFEDGAQHETPDDWQRDRYPWFNHNAALNVEV
GLGGKVTTLDGHPHWQPAFVLQGEAWDLPVVGYQNGVSQPLRLWQAKHAQPFNLNRFNDG
DFLRAEQQGIDAEKLTKVLYPNDNHQNGKKLRLMQQYFQCACALADILRRHHQAGRSIES
LADHEVIQLNDTHPTLAIPELMRLLLDEHQLSWDRAWQITQQTFAYTNHTLMPEALECWD
VRLVRSLLPRHMMIINTLNAQLKTRVEARWPGDQAKWAKLALVHNNQLRMANLCVTSGFA
VNGVAALHSKLVVQDLFPEYHQLWPEKFHNVTNGITPRRWINQCNPALSALIDKTLQKPW
LNDLDALQGLEAFADDAAFRAEYRAIKQQNKEALAKWIAARTRIEIDPEALFDVQIKRLH
EYKRQHLSLLHIIALWQTLVTDPQANRVPRVVLFGAKAAPGYALAKNIIYAINKVAETIN
QDPRVGNRLKVVFVPDYNVSVAERLIPAADLSEQISTAGKEASGTGNMKLALNGALTIGT
LDGANVEIAEQVGSENIFIFGHTVDQVVALKADGYAPAQWRKKDHQLNQVLQALEDGTFS
QGDCTAFDAMLHSLGPEGGDPYLVLADFQPYLDAQAQVEALWSDQDAWTRATILNTARCG
MFSSDRAIRDYQQRIWQATR

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	91	798	5.4e-264	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	59	797	69	809	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	7	798	5	748	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	2	800	1	798	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	25	797	11	793	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	14	797	3	794	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV51752.1	0.0	1	800	1	800
QIA54699.1	0.0	1	800	1	800
QAV47119.1	0.0	1	800	1	800
AOE42096.1	0.0	1	800	1	800
AZI53134.1	0.0	1	800	1	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ECP_A	0.0	2	800	1	796	TheCrystal Structure Of The E. Coli Maltodextrin Phosphorylase Complex [Escherichia coli],2ECP_B The Crystal Structure Of The E. Coli Maltodextrin Phosphorylase Complex [Escherichia coli]
7TM7_A	0.0	1	800	9	804	ChainA, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286],7TM7_B Chain B, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286]
1L5V_A	0.0	2	800	1	796	CrystalStructure of the Maltodextrin Phosphorylase complexed with Glucose-1-phosphate [Escherichia coli],1L5V_B Crystal Structure of the Maltodextrin Phosphorylase complexed with Glucose-1-phosphate [Escherichia coli],1L5W_A Crystal Structure of the Maltodextrin Phosphorylase Complexed with the Products of the Enzymatic Reaction between Glucose-1-phosphate and Maltotetraose [Escherichia coli],1L5W_B Crystal Structure of the Maltodextrin Phosphorylase Complexed with the Products of the Enzymatic Reaction between Glucose-1-phosphate and Maltotetraose [Escherichia coli],1L6I_A Crystal Structure of the Maltodextrin Phosphorylase complexed with the products of the enzymatic reaction between glucose-1-phosphate and maltopentaose [Escherichia coli],1L6I_B Crystal Structure of the Maltodextrin Phosphorylase complexed with the products of the enzymatic reaction between glucose-1-phosphate and maltopentaose [Escherichia coli],2ASV_A Chain A, Maltodextrin phosphorylase [Escherichia coli],2ASV_B Chain B, Maltodextrin phosphorylase [Escherichia coli],2AV6_A Chain A, Maltodextrin phosphorylase [Escherichia coli],2AV6_B Chain B, Maltodextrin phosphorylase [Escherichia coli],2AW3_A X-Ray studies on maltodextrin phosphorylase complexes: recognition of substrates and cathalitic mechanism of phosphorylase family [Escherichia coli],2AW3_B X-Ray studies on maltodextrin phosphorylase complexes: recognition of substrates and cathalitic mechanism of phosphorylase family [Escherichia coli],2AZD_A Chain A, Maltodextrin phosphorylase [Escherichia coli],2AZD_B Chain B, Maltodextrin phosphorylase [Escherichia coli]
1E4O_A	0.0	2	800	1	796	Phosphorylaserecognition and phosphorolysis of its oligosaccharide substrate: answers to a long outstanding question [Escherichia coli],1E4O_B Phosphorylase recognition and phosphorolysis of its oligosaccharide substrate: answers to a long outstanding question [Escherichia coli],1QM5_A Phosphorylase recognition and phosphorylysis of its oligosaccharide substrate: answers to a long outstanding question [Escherichia coli],1QM5_B Phosphorylase recognition and phosphorylysis of its oligosaccharide substrate: answers to a long outstanding question [Escherichia coli]
1AHP_A	0.0	1	800	1	797	ChainA, E.COLI MALTODEXTRIN PHOSPHORYLASE [Escherichia coli],1AHP_B Chain B, E.COLI MALTODEXTRIN PHOSPHORYLASE [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P00490	0.0	1	800	1	797	Maltodextrin phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=malP PE=1 SV=7
P73511	1.35e-252	60	796	82	824	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1
P0AC86	2.58e-241	34	796	40	808	Glycogen phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=glgP PE=3 SV=1
P0AC87	2.58e-241	34	796	40	808	Glycogen phosphorylase OS=Shigella flexneri OX=623 GN=glgP PE=3 SV=1
P45180	6.80e-235	25	797	36	813	Glycogen phosphorylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000003	0.000024	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003803_00087.