CAZyme Information: MGYG000003791_00100

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Brevibacteriaceae; Brevibacterium
• CAZyme ID: MGYG000003791_00100
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		59586.59	10.1001

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003791	2144765	MAG	Canada	North America

• Gene Location: Start: 18077; End: 19699 Strand: -

Full Sequence      

MSSLASGTRSSAGAQRVRATGLRACVPQNPALTSVWGWVWPLLIAAVGGFLRMLRLDHPR
ELIFDETYYVKDAHSIAHHGVELKWAEDANGKFAAGDFSALTDDPSYVVHPPLGKWILGA
GQLLFGDGANPFGWRFAAALIGTISIVIIARIAIRMFGSVWLGAAAALLLAADGQHFVHS
RTGLLDIFVMFFVLIAFWLLLIDRDDARRKILQRTGPSVDKQHTGSKPWFMPASFGPSLG
LRPWRLAGGIALGLACGVKWNGLYALAVFGIMIVLWDVANRRAAGIRRPWLAALGKDSVP
AFMSLVPVAGIVYLLCWTGWILSPKGWDRGWAAGNSGWWDFLPDWLVSLAHYHYTAYNFH
VGLDKPHTYMSNPWGWSVQWRPTSFYYRSYGLGEHGCTVEKCSAAILSVGNPVVWGLGTV
ALVVVLLAWVLRRDWRAGAILAGLAAVWLPWFNYQHRTIFTFYTIVMVPFIVLALVYALG
IAWGTAAGSASARSLQARRLAVAAILAAAVLVFAFYYPIWTGTTIPYDSWRMRMLNPTWI

Enzyme Prediction     

No EC number prediction in MGYG000003791_00100.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	44	320	2.1e-75	0.9865470852017937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	1.69e-19	26	316	12	263	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG4346	COG4346	1.65e-06	110	489	136	421	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	1.39e-05	50	276	9	201	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1807	ArnT	1.61e-04	31	277	2	196	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIN29095.1	2.06e-231	35	540	64	568
AZL14880.1	2.42e-199	38	539	37	582
AZT99217.1	3.42e-199	38	539	37	582
AZL11291.1	4.85e-199	38	539	37	582
AZL07707.1	9.75e-199	38	539	37	582

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	1.70e-83	27	539	27	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	3.24e-81	32	539	38	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	3.24e-81	32	539	38	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	2.30e-59	34	539	34	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
Q9C100	1.03e-07	41	295	61	277	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999434	0.000578	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
32	54
131	150
157	179
183	202
260	279
299	321
409	431
435	452
459	481
501	523