CAZyme Information: MGYG000000096_00179

Basic Information

• Species: Leuconostoc pseudomesenteroides
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Leuconostoc; Leuconostoc pseudomesenteroides
• CAZyme ID: MGYG000000096_00179
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	MGYG000000096_1|CGC3	61097.98	5.5644

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000096	2296803	Isolate	Canada	North America

• Gene Location: Start: 182334; End: 183932 Strand: -

Full Sequence      

MIFHINATMPEQKSGIEHAEIQRFMLFKKNHIAQKLILRDWDPECHRQTRAAGIDDDDLI
NMFDYFQKATIVATQKLTIKDLDFGVVDLEFNDEPQNNRYLVVDNSKKLVARVNYNNAET
QRVKSVELFDGFGNLYRVDHYDIRGFKSLQQWYTPDNKIESETWLDVHGQPVLESFFKTT
KTVNHQSELIRTNWHLTFNEISYDFDTIEDLTIYFLDAINQTFFNTLEPNIFILDRSHLA
DYGLLHLKNPAYTVLHLHNSHAGDAQEPMQSVLNNNYEFAMNALNQYDAVVSATPQQTRD
IKLRFQPSVPLFTIPVGIVKDTLLHAKRVRVGERQFGKVVAFARIAWEKHLDDLVRAVGI
VKEEIPEVSLDLYGYADPTDDFRAKRAVEAVIDKYHLGDSVTMRGYTTNIDAVENQAMIY
GLTSRMEGFNLAIMEGIAHGLIALTYDVNYGPNEIVQDNINGKIVPYGDYQAMANAVLTV
LRDPRLAQRYSDGAYQSAERYSETNVMAAWQKLIDDANQKWQHKIAATNLGR

Enzyme Prediction     

No EC number prediction in MGYG000000096_00179.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	339	489	3.1e-24	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04949	GT4_GtfA-like	6.20e-97	204	510	36	328	accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.
cd03820	GT4_AmsD-like	5.66e-34	338	512	183	351	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03801	GT4_PimA-like	3.67e-26	254	514	109	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.20e-25	244	520	105	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	1.20e-24	301	509	155	356	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQB28247.1	0.0	1	532	1	532
QEA42200.1	0.0	1	532	1	532
QQB01017.1	0.0	1	532	1	532
QSB51006.1	0.0	1	532	1	532
QNN74677.1	8.35e-262	1	528	1	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EC2_A	4.43e-59	4	515	4	491	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC2_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC3_A	1.90e-50	1	514	2	494	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC3_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC1_A	1.90e-50	1	514	2	494	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC1_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC4_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC4_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC6_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC6_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFK_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFK_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFM_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFM_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFN_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFN_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC7_A	3.42e-48	3	514	3	493	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC7_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFO_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFO_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
4PQG_A	1.11e-31	2	516	11	507	Crystalstructure of the pneumococcal O-GlcNAc transferase GtfA in complex with UDP and GlcNAc [Streptococcus pneumoniae TIGR4],4PQG_B Crystal structure of the pneumococcal O-GlcNAc transferase GtfA in complex with UDP and GlcNAc [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3S2Y2	3.55e-34	1	516	2	503	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit OS=Streptococcus agalactiae OX=1311 GN=gtfA PE=1 SV=1
A0A0H2URG7	5.59e-31	2	516	3	499	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtfA PE=1 SV=1
P13484	7.41e-31	113	510	148	515	Poly(glycerol-phosphate) alpha-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagE PE=1 SV=1
A1C3L9	7.34e-29	2	516	3	500	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit OS=Streptococcus parasanguinis OX=1318 GN=gtfA PE=1 SV=1
Q9AET5	4.40e-25	2	516	3	499	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit OS=Streptococcus gordonii OX=1302 GN=gtfA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000096_00179.