CAZyme Information: MGYG000001295_00183

Basic Information

• Species: Desulfovibrio fairfieldensis
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio fairfieldensis
• CAZyme ID: MGYG000001295_00183
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	MGYG000001295_1|CGC1	41815.33	8.7005

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001295	3663932	Isolate	not provided	not provided

• Gene Location: Start: 205771; End: 206916 Strand: +

Full Sequence      

MPAVSSSASSISFQRKSIHVVHVVESFAAGCLVALATLCHAVRNGIQHSIIHALRPESPE
RFVELFPTDVAFYFLPMTRLIRIGADLRVFGQLCGMLRRIQPDVVHCHSSKAGFLGRWAA
RREGLPSVYTPHGYAFLRTDVGSLQRACFKTAEWLAARAGNAIVACGEEEYALSRLLASR
NDQVLCIPNSLNLVELDALRRTVPPACLHPDAIMVGTCGRLEPQRNPDLFSALVLMLKDE
ARWTWIGAPRQNAALPPQVECPGWLSRGEALARLAALDVYVQTSLWEGLSYAVLEAMALG
KAVVATDIPANRTIVRHGVTGFLGSTPQELASHVHRLVHDAPLRRRMGAAARRCVEERHD
AQKAYLAYDRLYHGLAGDGKP

Enzyme Prediction     

No EC number prediction in MGYG000001295_00183.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	215	348	1.1e-19	0.91875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03808	GT4_CapM-like	1.20e-48	16	368	1	357	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03801	GT4_PimA-like	4.56e-42	42	373	28	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	5.99e-30	40	379	27	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03811	GT4_GT28_WabH-like	2.67e-28	86	323	68	309	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03807	GT4_WbnK-like	1.47e-24	19	373	1	362	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRR15274.1	1.93e-65	20	378	6	363
QVN10981.1	2.71e-65	20	378	6	363
AJY24271.1	3.82e-65	20	378	6	363
AXF23713.1	1.50e-64	20	378	6	363
AOJ89196.1	2.98e-64	20	378	6	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVP_A	4.52e-07	67	371	57	399	Structureof Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71053	7.14e-13	86	369	63	375	Putative glycosyltransferase EpsD OS=Bacillus subtilis (strain 168) OX=224308 GN=epsD PE=2 SV=1
A0QRG8	7.40e-11	92	355	80	347	GDP-mannose-dependent alpha-mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=mgtA PE=3 SV=1
Q6DIQ1	8.55e-11	281	379	245	343	Glycosyltransferase 1 domain-containing protein 1 OS=Xenopus tropicalis OX=8364 GN=glt1d1 PE=2 SV=1
A4FUP9	1.54e-10	281	375	246	340	Glycosyltransferase 1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Glt1d1 PE=2 SV=2
Q48453	2.93e-10	19	323	2	306	Uncharacterized 41.2 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999990	0.000052	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001295_00183.