CAZyme Information: MGYG000001476_00556

Basic Information

• Species: Caproiciproducens sp000752215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Caproiciproducens; Caproiciproducens sp000752215
• CAZyme ID: MGYG000001476_00556
• CAZy Family: GT4
• CAZyme Description: GDP-mannose-dependent alpha-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000001476_8|CGC2	43150.49	8.2402

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001476	3737722	Isolate	not provided	not provided

• Gene Location: Start: 71929; End: 73089 Strand: +

Full Sequence      

MRIAFFTDTFYPQVNGVSNTLSYLSRYLQARKIAHVFFAPDYGFDSDECAGLPVIRFKGF
CPIIYPECRIAFAPLEKITGLLADFAPDVVHIVTELSMGLVGLRAAEALGIPVVMSYHTN
FDKYLHFYHLTYFSQALWHYMKWFHSFALVNLCPSRDTLESMKRRGFQNLGIWSRGIDLD
RFSPSHFSPELRERLGARGKTVFLYVGRVSVEKGLDVLMQSIRGVNETHGDRVQFWITGD
GPFLKEIASLKLPNVVFTGEKRGTELAQVYASADAFVFPSGTETFGNVLLEAMASGLAPI
CTDSGGVTDYTVHGENALVCRYGDSGSLSRAILGLLDPQLRSRIRRQALQTAKSRSWDSI
FDSLMLHYGSAALSLPARRQADIHKS

Enzyme Prediction     

No EC number prediction in MGYG000001476_00556.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	198	342	2.5e-31	0.93125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03814	GT4-like	1.23e-130	2	369	1	365	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases and includes a sequence annotated as alpha-D-mannose-alpha(1-6)phosphatidyl myo-inositol monomannoside transferase from Bacillus halodurans. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.
cd03817	GT4_UGDG-like	3.03e-74	2	364	1	372	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03801	GT4_PimA-like	7.63e-62	2	368	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
PLN02871	PLN02871	1.36e-59	2	382	60	445	UDP-sulfoquinovose:DAG sulfoquinovosyltransferase
COG0438	RfaB	4.55e-55	1	368	1	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1245716.1	2.37e-227	1	379	1	379
AKG34176.1	2.35e-174	1	372	1	372
QWU17939.1	3.34e-174	1	372	1	372
AIQ12274.1	4.74e-174	1	368	1	368
BCG58591.1	5.49e-173	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4N9W_A	3.48e-12	40	368	52	364	Crystalstructure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155],4NC9_A Crystal structure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155],4NC9_B Crystal structure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155],4NC9_C Crystal structure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155],4NC9_D Crystal structure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155]
2GEJ_A	3.70e-12	40	368	68	380	CrystalStructure of phosphatidylinositol mannosyltransferase (PimA) from Mycobacterium smegmatis in complex with GDP-Man [Mycolicibacterium smegmatis MC2 155],2GEK_A Crystal Structure of phosphatidylinositol mannosyltransferase (PimA) from Mycobacterium smegmatis in complex with GDP [Mycolicibacterium smegmatis MC2 155]
6KQI_A	1.09e-11	172	337	206	384	CrystalStructure of protein1 [Homo sapiens]
5U09_A	1.12e-11	172	337	210	388	High-resolutioncrystal structure of the human CB1 cannabinoid receptor [Homo sapiens]
3L01_A	1.68e-11	176	358	220	417	ChainA, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NT41	1.19e-48	1	368	7	371	GDP-mannose-dependent alpha-mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=mgtA PE=1 SV=1
P9WMY4	2.90e-48	1	368	4	366	GDP-mannose-dependent alpha-mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=mgtA PE=3 SV=1
P9WMY5	2.90e-48	1	368	4	366	GDP-mannose-dependent alpha-mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mgtA PE=1 SV=1
A0QRG8	9.55e-42	1	368	1	363	GDP-mannose-dependent alpha-mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=mgtA PE=3 SV=1
Q8S4F6	5.61e-41	2	373	105	481	Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001476_00556.