CAZyme Information: MGYG000002681_00801

Basic Information

• Species: UMGS1975 sp900546685
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QAND01; UMGS1975; UMGS1975 sp900546685
• CAZyme ID: MGYG000002681_00801
• CAZy Family: GT4
• CAZyme Description: Alpha-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	MGYG000002681_34|CGC1	44851.88	6.4265

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002681	1889419	MAG	Canada	North America

• Gene Location: Start: 6300; End: 7490 Strand: -

Full Sequence      

MQTPLTIGQFNDGYLPVTDGVVTVVRNYAYWLNEKYGKCVVYAPNAKHYQNEESFDVQPY
LSMPIPGRKPYRLGFPVFDASYRRQVDSMQFDLVHSHSPFSAGSEALRVAKKQHIPLVGT
FHSKFYDDFVQYFHSDRIARAGVNFVIKFFQKCDSVWTVSDATVETLREYGYQGPITVIN
NGTDLAAPETQAEIDDAKQQAEALCSLRPDQPLFVFVGQHIWQKNVRLILEAAEQLRHIE
PDFRLVFVGTGYAQHDMQAFIDEHAGMAQQVSLLGTIQNRTLLSYLYLRASAFVFPSVYD
NAPLVVREASAMGAPSILIQGSTAAQGVEDKVNGFLCQNSVESLRDTMLYCLQHPQQAQE
IGKKAQKTLAKSWSMIVDQVYEEYLRIIENYKAKNQ

Enzyme Prediction     

No EC number prediction in MGYG000002681_00801.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	208	363	1.5e-27	0.9625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03817	GT4_UGDG-like	1.39e-95	7	384	2	372	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03801	GT4_PimA-like	2.69e-47	7	389	2	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.05e-45	10	390	6	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03814	GT4-like	1.28e-39	7	385	2	365	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases and includes a sequence annotated as alpha-D-mannose-alpha(1-6)phosphatidyl myo-inositol monomannoside transferase from Bacillus halodurans. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.
cd03811	GT4_GT28_WabH-like	9.37e-30	20	368	13	341	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANW98186.1	1.46e-126	1	396	1	392
AGI38824.1	1.46e-126	1	396	1	392
ANX00727.1	1.46e-126	1	396	1	392
AGC67781.1	1.46e-126	1	396	1	392
QVK19407.1	1.50e-122	5	392	3	386

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q93P60	6.90e-22	5	366	1	365	Alpha-monoglucosyldiacylglycerol synthase OS=Acholeplasma laidlawii OX=2148 GN=mgs PE=1 SV=1
Q8CWR6	2.15e-16	5	336	1	330	Alpha-monoglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0982 PE=1 SV=1
Q8S4F6	8.06e-08	92	383	191	475	Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1
P71053	1.10e-07	83	368	71	351	Putative glycosyltransferase EpsD OS=Bacillus subtilis (strain 168) OX=224308 GN=epsD PE=2 SV=1
O05083	4.22e-07	153	388	138	353	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002681_00801.