CAZyme Information: MGYG000003143_01312

Basic Information

• Species: Clostridium_J sp900548455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_J; Clostridium_J sp900548455
• CAZyme ID: MGYG000003143_01312
• CAZy Family: GT4
• CAZyme Description: Ubiquinone biosynthesis O-methyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1138		131366.79	4.7923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003143	3911084	MAG	United States	North America

• Gene Location: Start: 81838; End: 85254 Strand: -

Full Sequence      

MDDKNIINIKKRIENLINQNFCDEAINLLDQLINILPEDMDVYSMYSVALLMQGKLEEAE
KLCNRGLDLDCFNFDLNYNLAYIKESKGEYSKAVTFYNQAITSCDDEEMKNQIKEAIGNI
ETNFKVESAKKIVFFVKRGLDSFLSDIINFMSTEYIVKKVVVENFEQIDVGMNWADICWF
EWCDELITYGSNSELAQNKKIICRLHRYETFTEFPSKVDWNRVDKLIIVAEHLKDLLKAQ
VPDIEEMVDIIHINNGVDINKFNLISRNKGYNLAYVGYIHPRKNPYLLLQIIAKLVTMDK
RYKLYVAGKFQDSLVELYWKYQVKEMGLENNVVFDGWQSDISAWLSDKNYILSTSIHESF
GYGIAEAMCRGIKPIIHNFVFSEGIWDRKYLFNTIDEAVAQIRDKKYNSLEYRSYIESNY
SLAIQESKTKELLNGIYEEKYEDKYIEKLNKFTLGNVISCVNDFNLYSCDEIERYNFDSA
RIYMGKREVANESIDIIEFIITNNEKKKLVITGGMYHKETGQLEFSEAIMKSNKYNEICK
LAKCILNDNYNFGNSNLKGYIYDENRIEDVKENSIIYSWERAIPATHFMPILGYRNIIAR
YYIASKYLKNDYTVLEAACGYGYGAAYMSNKCLKIHAVDLAEDNILFSKECYSKNNINWE
VGDVLKLPYEDNKFDIYTSFETLEHLDVDKINQYFVEGKRVLKSDGKMIISTPNKTNRLG
INNPYHIKEYTEEELDKILTSHFKYIVYYSIDDKGILNNGVSLKAVNIIAVCSDEEIEDP
YKKYLLKKFNKNVDDMNNTEELVSYLISTFQGNVMQDNIDDLTIMMASYNRGSLLKHNLK
NGLVFGHQTKVIVDDCSDDGNKEIIKSCIGNYGVESILFNNINIGVAESTEKLINLVNTK
YVMGCGDDDNLICLNYDGFKDEFENLNGSDIIIPRYILNLDEDNNLSVGYDRKEINKVPA
SEILKLMISSGEMFAFNAGAVFISDEYKRSCAEKVFKVAEDYVTLSRILGNNLQRTIKVS
NNYVYVRRISNNTLSRTINKSKLTLNLLSLLVSGYYCCTNNLISFSDVKEYIQYRGALLS
ELYGFGIEISDLIINYLNNDITLESFLKKVVKEGDMEDISLEDIPQEIINICTKGRGA

Enzyme Prediction     

No EC number prediction in MGYG000003143_01312.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08241	Methyltransf_11	7.43e-21	615	710	1	94	Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
pfam13649	Methyltransf_25	8.32e-19	614	706	1	97	Methyltransferase domain. This family appears to be a methyltransferase domain.
cd03801	GT4_PimA-like	1.12e-18	221	376	139	295	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03811	GT4_GT28_WabH-like	2.28e-17	195	376	103	290	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
COG0438	RfaB	3.81e-16	190	440	118	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUN37879.1	2.01e-277	9	772	5	767
AJE09570.1	7.68e-229	9	772	11	1086
ACQ54354.1	7.68e-229	9	772	11	1086
APR01690.1	7.68e-229	9	772	11	1086
AXG93706.1	7.68e-229	9	772	11	1086

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VE3_A	4.93e-12	606	744	34	181	Crystalstructure of PH0226 protein from Pyrococcus horikoshii OT3 [Pyrococcus horikoshii],1VE3_B Crystal structure of PH0226 protein from Pyrococcus horikoshii OT3 [Pyrococcus horikoshii]
3L8D_A	3.55e-08	593	711	38	152	Crystalstructure of methyltransferase from Bacillus Thuringiensis [Bacillus thuringiensis str. Al Hakam]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003143_01312.