CAZyme Information: MGYG000004118_00326

Basic Information

• Lineage: Bacteria; Firmicutes_B; Dehalobacteriia; UBA4068; UBA4068; HGM13862
• CAZyme ID: MGYG000004118_00326
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000004118_25|CGC1	81486.96	6.8698

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004118	1412421	MAG	United Kingdom	Europe

• Gene Location: Start: 3394; End: 5589 Strand: +

Full Sequence      

MKIMHFAGGGDIGGAKTHILSLGKELAENNQFRLISFRKGPFSEEAKAKGLDVVEVENAW
NLFSCLHVALKAVDEFKPDIIHCHGAKANMMGVMVKKLRHIPICTTVHSDPTRDYMGSPV
KQLVFGSINGWALNRMDYYMAVAGEMERSLISMGMDPQRIFIIHNGLDFSHAEDKYRDKS
DDEEIVIGIAARLTPIKNIPLLLRAFASAHARNPRLRLKIAGTGEDELELKKLARSLHID
QQTDFVGWVSDMASFFRGIDINVLSSFSETFPYSLLEGAYEHCAAVASKVGGIPELIQDG
KSGLLFAPDDENALAEDIYRLSVDGQLRRTLAENLFKRAKEEFSLANMCRVQERSYGLML
ERSQHQKRWGAVICGAYGRGNSGDEAILQAIVAQMREIDPHMPLTVLSRDKLDTRQKNKT
NAIYIFNIYSFFKNLRRSQIFINGGGSLIQDVTSSRSLYFYLFTLWAARICGCRVIMYGC
GIGPIKKGFNQRIASSVLNKNVEIITLRDSNSVAVLQEMSVSRPRIMLSADPTVNLTKAS
PDEIQQAFSKEQVPIDVPKIGFCLRSWPGFDHPEYVAAAADYAYQQYGLYPVFIPIELPK
DIAIAQKVASFMQAPFYALQERHVVEELIGMLGEMSLVVGMRLHSLIFATSCGTPVIGIS
YDIKVDSFIHDIGSECCIPLSRLTFDELKKQIDMIAATGFARAEDAASKLRLNEEINVAS
VRELLDLPAND

Enzyme Prediction     

No EC number prediction in MGYG000004118_00326.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	180	330	1.3e-33	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03609	S_layer_CsaB	1.12e-75	371	677	1	293	polysaccharide pyruvyl transferase CsaB. The CsaB protein (cell surface anchoring B) of Bacillus anthracis adds a pyruvoyl group to peptidoglycan-associated polysaccharide. This addition is required for proteins with an S-layer homology domain (pfam00395) to bind. Within the larger group of proteins described by pfam04230, this model represents a distinct clade that nearly exactly follows the phylogenetic distribution of the S-layer homology domain (pfam00395). [Cell envelope, Surface structures, Protein fate, Protein and peptide secretion and trafficking]
cd03801	GT4_PimA-like	2.11e-56	2	350	1	359	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03808	GT4_CapM-like	6.19e-51	2	350	1	355	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03807	GT4_WbnK-like	9.02e-47	2	356	1	361	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd03798	GT4_WlbH-like	1.46e-46	70	344	88	361	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA31360.1	8.13e-204	1	726	1	739
ANU41018.1	2.30e-203	1	726	1	739
QQR06197.1	2.30e-203	1	726	1	739
QBB65482.1	3.36e-201	1	727	1	742
ALP94503.1	6.73e-201	1	727	1	742

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3C4Q_A	4.92e-18	8	340	17	387	Structureof the retaining glycosyltransferase MshA : The first step in mycothiol biosynthesis. Organism : Corynebacterium glutamicum- Complex with UDP [Corynebacterium glutamicum],3C4Q_B Structure of the retaining glycosyltransferase MshA : The first step in mycothiol biosynthesis. Organism : Corynebacterium glutamicum- Complex with UDP [Corynebacterium glutamicum],3C4V_A Structure of the retaining glycosyltransferase MshA:The first step in mycothiol biosynthesis. Organism: Corynebacterium glutamicum : Complex with UDP and 1L-INS-1-P. [Corynebacterium glutamicum],3C4V_B Structure of the retaining glycosyltransferase MshA:The first step in mycothiol biosynthesis. Organism: Corynebacterium glutamicum : Complex with UDP and 1L-INS-1-P. [Corynebacterium glutamicum]
3C48_A	5.38e-18	8	340	37	407	Structureof the retaining glycosyltransferase MshA: The first step in mycothiol biosynthesis. Organism: Corynebacterium glutamicum- APO (OPEN) structure. [Corynebacterium glutamicum],3C48_B Structure of the retaining glycosyltransferase MshA: The first step in mycothiol biosynthesis. Organism: Corynebacterium glutamicum- APO (OPEN) structure. [Corynebacterium glutamicum]
6EJJ_A	7.71e-16	1	348	3	346	Structureof a glycosyltransferase / state 2 [Campylobacter jejuni],6EJJ_B Structure of a glycosyltransferase / state 2 [Campylobacter jejuni]
6EJI_A	3.29e-15	13	348	15	346	Structureof a glycosyltransferase [Campylobacter jejuni],6EJI_B Structure of a glycosyltransferase [Campylobacter jejuni],6EJK_A Structure of a glycosyltransferase [Campylobacter jejuni],6EJK_B Structure of a glycosyltransferase [Campylobacter jejuni]
5I45_A	1.44e-14	154	364	5	217	1.35Angstrom Crystal Structure of C-terminal Domain of Glycosyl Transferase Group 1 Family Protein (LpcC) from Francisella tularensis. [Francisella tularensis subsp. tularensis SCHU S4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NTA6	2.53e-17	8	340	17	387	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=mshA PE=1 SV=1
A4QB40	2.53e-17	8	340	17	387	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium glutamicum (strain R) OX=340322 GN=mshA PE=3 SV=1
Q59002	8.60e-16	12	361	15	386	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
Q0P9C5	3.70e-15	1	341	2	339	GalNAc-alpha-(1->4)-GalNAc-alpha-(1->3)-diNAcBac-PP-undecaprenol alpha-1,4-N-acetyl-D-galactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglH PE=1 SV=1
C4LLD6	3.02e-14	25	382	86	451	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717) OX=645127 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004118_00326.