CAZyme Information: MGYG000004437_00234

Basic Information

• Species: UMGS1224 sp900549775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1224; UMGS1224 sp900549775
• CAZyme ID: MGYG000004437_00234
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
723		84580.59	7.5992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004437	1139688	MAG	Israel	Asia

• Gene Location: Start: 205606; End: 207777 Strand: -

Full Sequence      

MKIKELFLKSCYILRKDGMLALLKKFFHVIHFRWKVKRGKLMDKCFCDVLFINGCTLPHP
HRYRVSHQIEQLKSNNFSAQEVFYQNLSMDYIKRYRCFIFFRCPITDTIERFIELAKKEN
KRVFFDIDDLVIDEKYTSQIKYLDSLSESELRLYNDGVNRMQKTLKLCDYAITSTERLAD
ELRSYVGEVFINRNTVSEEMVKLSLKALKNKKALSNRKNDKVVLGYFSGSITHNDDFELI
LPSVLKIMEENPNVYLKIVGLLDVPEELKPFKDRILKYKFADWKRLPEIICSVDVNLVPL
CNNIFNEAKSENKWIEASLCKTVTIASNIGAFKTCIENEVDGILCEDDEWFEKLGYLIKN
EEYRNKVAENAFKKVKREKVTTYTGKPLVDFIERKLSKNICFVLPTVNTSGGVNVVLKHC
EILKKHSWDVTIINQDIKENINASTYEINVISAMTTHIIAHIDVCVGTLWSTMYFVNDIP
NAKNKKYLVQSFETDFYENGSALKQLANSTYNFDNVDYLTVSKWCKSWLEDKFDQRVKFV
QNGLDLKLFPFRQRMFEGKIKILIEGNSKSYYKNVDESFKIIEKLDRDKFEIYYLSYEGK
PKDWYHVDRFYNDVPYERVGNIYNECDILIKSSILESFSYPPLEMMATGGICIVAPNDGN
MEYLKDGYNCLLYNPGNIDQAVDLINSVVSDRMLRERIIKNGLETAEQRSWDNIEKNVIG
LYE

Enzyme Prediction     

No EC number prediction in MGYG000004437_00234.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.16e-29	399	723	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03794	GT4_WbuB-like	3.99e-23	115	378	118	380	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	2.06e-17	519	723	155	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	2.10e-17	570	704	12	157	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03801	GT4_PimA-like	4.54e-14	158	377	131	350	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFH59669.1	5.96e-286	1	723	1	723
QQV05331.1	1.64e-283	2	722	5	722
QDY84365.1	7.68e-282	1	722	1	727
QOT09872.1	7.43e-270	1	723	1	722
ANF98440.1	2.04e-269	1	723	1	729

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59002	7.75e-09	509	722	145	381	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
Q58577	4.59e-07	509	723	135	347	Uncharacterized glycosyltransferase MJ1178 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1178 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004437_00234.