CAZyme Information: MGYG000004887_00153

Basic Information

• Species: UBA1417 sp002305575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1417; UBA1417 sp002305575
• CAZyme ID: MGYG000004887_00153
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813		94259.54	9.2666

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004887	1742912	MAG	China	Asia

• Gene Location: Start: 15111; End: 17552 Strand: -

Full Sequence      

MIKKMFSQLRKMKWRELRNHYWPRLRYPTYYRKLPIDDHAILLEASHGKQMQGNIYYLLK
VLASDPRYREYRIYLSAHKTVAESFREALDRDGLNRVELAVVFTKKYMRLIASAKYLIND
TTFLPFFVKRPEQVYLNTWHGTPLKTLGKKVNNDLHNIGNVQKNFFMADYLLYPNVYTMK
HMVEDYMLEDLSKAKILLAGYPRNTAFFDKKHAAEIREELELADKRVYAFMPTWRGVVGS
VDRKASTYIQYYLYELDKRLHEDEVLYVNLHPLARKDVSFAGMAHIQPFPEAYETYAFLN
AADCLITDYSSVFYDFAVSRKKCVLFTYDEAEYFADRGLYRPLSALPFPSVKTVDELVEA
VRAPKSYDDTAFLREYCAYDNAEAAAQLCARVILNEPSSAIEERDMPSNGKRNVLLYVGN
LAQNGITTSVMNLLRNVDRTRYNFYFTFESGKVRANRAILQHLPSGTRYIATTGKINLTF
WQKVVYLLFMARLFPLAPYLRVMRTAYPMEIRRNYGDAVFSDVIQFNGYETKKILFFAAF
DANRVIYVHSDMQMEIRTRGNQRKNVLRYAYETYDHVAVVTEDIVEPTRSFLKKDRPFDL
GRNLIADRTIRKKGEKPIAFDPQTRCNVPFETLMDIVARDAKRIVSVGRFSPEKGQRRLI
DAFVRVWQENPASYLIIIGGNQRDGLYGQLCDYVSALPCRDHIVLILTMSNPFPLIKACD
GFILSSFYEGFGLVLAEADILGLPVVSTDITGPRRFMQAHGGVLVENSEAGLEDGLRRLL
NGQIPKLHIDYDAYNREAVEEFYKLLDKDGKTK

Enzyme Prediction     

No EC number prediction in MGYG000004887_00153.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	641	781	1.1e-25	0.88125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	4.89e-55	35	394	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
cd03811	GT4_GT28_WabH-like	2.85e-41	413	803	1	349	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
COG1887	TagB	2.18e-33	31	381	19	366	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
pfam00534	Glycos_transf_1	3.13e-24	640	796	1	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03801	GT4_PimA-like	1.50e-23	495	781	56	332	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL33357.1	1.43e-275	15	807	13	808
CBK97012.1	1.16e-274	15	807	13	808
QQQ92281.1	2.32e-204	27	808	20	798
ANU74732.2	3.62e-204	27	808	34	812
ASU27537.1	3.62e-204	27	808	34	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	4.95e-23	36	385	350	707	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	3.47e-22	36	385	350	707	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	7.98e-22	36	385	350	707	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RKI5	1.56e-29	34	393	27	393	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q2G1C1	5.66e-27	33	392	23	387	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P13485	2.48e-24	33	368	376	712	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q5HLM5	2.67e-22	36	385	350	707	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKJ1	2.75e-20	34	388	24	376	Teichoic acid ribitol-phosphate primase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarK PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004887_00153.