CAZyme Information: MGYG000001262_00262

Basic Information

• Species: Sphingomonas ginsenosidimutans
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingomonas; Sphingomonas ginsenosidimutans
• CAZyme ID: MGYG000001262_00262
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749	MGYG000001262_5|CGC1	79875.64	6.8167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001262	3667136	MAG	Italy	Europe

• Gene Location: Start: 19514; End: 21763 Strand: -

Full Sequence      

MAGSLDSALHKAALAEKRGDMAEARRVLDAVLARFPANRRARVAADRLAQRAAEADAAPI
AELSRLHAFYAAGDHAGAAAGARTLAAAFPRDARVHALLGGALLAGDDALAAIAALRAAI
ALAPAEGAYHSNLGVALRRTGRAAEAEAAYRAAIAAAPDHADAHFNLANLLGAERRFDDA
FAAYDRALALAPRHVTAWYNRANLHRAARDAPAALRCYLALLDLAPDHADGLNNMGSLLI
ELDRPAEALAACRRATQAAPGNLKAWLNLGQAAEMAGALDEAQAALARATALDPDDAHAR
AHLLFLEAYMADWRGRDTFAALPIAMAAADRVIEPFVALPFEDDPARQLARARVYAQSSF
ARTAPPLVPAAPRADARIRIGYVSADFYDHATLNLMAGLLREHDRSRFEVRAYNYGPGEG
SAARAAILPHLDAFVDVRALDDAAAVARIRDDALDIAIDLKGYTKGARAPLFVDRIAPVQ
IGWLGYPGSLGSDALDYIIGDAVVIPPGAERDYSEQVIRLPGSYQANDDRRAIADAAHTS
RATFGLPDEALVLCCFNHPYKIGPREFDLWTRLLHAVPDAVLWLLRPNRWAEANLRREAA
ARGIDPGRLVFADMVPHAEHLARHVHADLFLDTFAVNAHTTASDAFWGGVPVLTLAGRQF
AARVGASLVTAIGLPELVAQSEAEYEAIALALANDRAALAALRARLAANRLVMPLFDTAR
HARAIEAAYATAHRRRLDGSPPAAFDVAG

Enzyme Prediction     

EC	2.4.1.255

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	192	736	6.6e-132	0.6226950354609929

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3914	Spy	6.49e-124	200	730	76	612	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
pfam13844	Glyco_transf_41	1.34e-78	374	722	77	540	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
sd00006	TPR	9.74e-16	165	255	5	95	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	2.38e-13	197	281	3	87	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
NF033920	C39_PA2778_fam	2.89e-07	178	260	173	255	PA2778 family cysteine peptidase. Members of this family are MEROPS classification C39 family cysteine peptidases, a group that includes many processing enzyme for peptide natural products such as lantibiotics and other bacteriocins. This family, more specifically, includes PA2778 as found in Pseudomonas aeruginosa. All members of the defining seed alignment are encoded in the vicinity of a homolog of PA2779 (see HMM NF033919). Note that the C-terminal region consists largely of tetratricopeptide repeats (TPR), so classification using this HMM must be based on comparing the top domain score to the second gathering threshold (GA2).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDK33945.1	8.95e-158	304	748	300	741
QSR17219.1	2.79e-156	304	748	300	741
QVM85125.1	2.43e-154	296	747	292	740
AXB75624.1	7.26e-150	296	747	292	740
QPL35198.1	4.04e-141	299	739	231	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JLB_A	1.89e-89	294	716	122	543	Xanthomonascampestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
2VSN_A	5.17e-89	294	716	122	543	Structureand topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]
5A01_A	1.04e-60	377	742	234	704	O-GlcNActransferase from Drososphila melanogaster [Drosophila melanogaster],5A01_B O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_C O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster]
5NPR_A	1.44e-59	374	742	228	709	Thehuman O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5NPS_A	1.46e-59	374	742	229	710	Thehuman O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9M8Y0	5.74e-71	333	747	537	966	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
Q8CGY8	8.64e-58	374	742	552	1033	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
P81436	1.17e-57	374	742	552	1033	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
O15294	1.58e-57	374	742	552	1033	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
Q27HV0	3.87e-57	374	742	552	1033	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa OX=9823 GN=OGT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001262_00262.