CAZyme Information: MGYG000001633_00193

Basic Information

• Species: RC9 sp000435075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000435075
• CAZyme ID: MGYG000001633_00193
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	MGYG000001633_2|CGC1	30772.15	4.9624

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001633	2721018	MAG	China	Asia

• Gene Location: Start: 43522; End: 44328 Strand: -

Full Sequence      

MGKKILFVNSEIFPYLPETPISRIGRYLPQGIQERKKEIRSFMPRYGCINERKNQLHEVI
RLSGMNIIINDVDRPLVIKVASISAARIQVYFIDNEDYFKRKELERDDNGVFFGDNAERA
IFFARGVLETVKKLRWAPDVIHCHGWITQILPLYLKKAYKDDPIFENSKVVLSLYDDTPE
IFNEEFSRLVKFGDITESDVPFLSEPTGINLAKTAAQYSDGVIVAAENVDKGLVDYCKGL
NLPVLDYDAKAVEDGSYIDAYNSFYDQF

Enzyme Prediction     

No EC number prediction in MGYG000001633_00193.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	4	223	3.4e-39	0.4449152542372881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	7.36e-50	5	223	1	214	Starch synthase catalytic domain.
PRK14098	PRK14098	2.08e-43	4	176	7	180	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	4.98e-37	4	222	1	212	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	2.82e-23	4	222	2	201	glycogen synthase GlgA.
COG0297	GlgA	2.30e-18	4	225	2	215	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGY44407.1	6.66e-113	3	267	4	265
QIA09804.1	1.34e-112	3	267	4	265
QKG78761.1	6.19e-112	4	268	7	268
SNV43872.1	9.27e-110	3	267	4	265
ADY34094.1	9.27e-110	3	267	4	265

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNG_A	3.16e-07	5	176	42	220	GranuleBound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa],6GNG_B Granule Bound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3EGV0	4.63e-41	4	220	7	222	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
Q3B6C3	4.69e-40	4	176	7	180	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B4SC83	1.26e-39	4	250	7	255	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
A1BIY8	6.58e-38	4	176	7	180	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
B4S584	2.51e-37	4	227	7	229	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001633_00193.