CAZyme Information: MGYG000000130_00091

Basic Information

• Species: Peptoniphilus_C sp902363535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Peptoniphilus_C; Peptoniphilus_C sp902363535
• CAZyme ID: MGYG000000130_00091
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
929		102762.56	4.8668

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000130	1967579	Isolate	Canada	North America

• Gene Location: Start: 83122; End: 85911 Strand: +

Full Sequence      

MGIKHTLRRKKTWQMLLAAILFLLVLLGGIVAIWIVSILKDLPPVDFDDLTTSIPQTSYI
LDAEGNPIDEVDPSVFSENISVDQVPDHVKEAFLAVEDRSFYKHHGLDFRQLGASILTNA
KSGAIERGGSTITQQLVKNVYLSSEQSLDRKIKEAYLTLGMEEKLGKDAILEAYLNRVDL
GLGSQGIEAASNAYFSKHAKDLTVEEGALLAGIVKSPASYQPIKRIPTEENDGANVIATQ
TIGDRSYDLIENPRAEERKKVVLRAMNQAGYITAEEAKSYAQIPISFMPKENPPSPYSSY
VADVISDEAVAILAKISHMDKQAAEKQVREGGLTIHSTIVGDFQKKMDALYDTYPALIAR
GKNKGANFVDFNTDGNDRMIDEEGHVLYYPYEALFDEKGNMHLPAGAFTKTDGGLEIDGE
YFTESNGNLLLKNLYYLDENGNLRTVAGAGTLFQAGDLKNPSTLLLQGELYEAYKDAIEI
TEEELVLPADLFLLPEKGSLQPQSAAIIADNTTGAIVALAGGNDLKDPARLRYNHLTSKR
QPGTAIVPLTTYLAALSEGDTLATSYDDTPMHVDGIIWPNADSFYGYDVLADGAANTRLA
ISGKILERYGFDPVLKNLNRLGLYKGERQDDAVKTPKENAKRHDMTYDAMAAGNFVDGMN
LMALTNSYARIASPSVSDNYTVQKITDRKGRVLYEHGKTAAKDIHREDALLRYALGRSPL
AENLRASGYDAFAVSGTNKYRADYFALGATPRYTYGLWMGNDLQKIALAGDRSLTESLYA
SLVAILGDGTPWELPADFEMHEVSDKTGLLATTYARRARSTVTLPFLPNTAPTKETQNYT
RKLICSVSGQLASTYCPYETITYGYYFVRPKGYDPKAFDGILPKDYYTLPSNYCQVHTKE
WYDQETQKANEDEQDQDNDNDQNRDTHRR

Enzyme Prediction     

No EC number prediction in MGYG000000130_00091.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	66	266	7.3e-58	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	1.15e-92	9	784	9	586	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.58e-90	9	835	3	767	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.20e-88	78	762	3	502	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	7.87e-65	64	267	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02071	PBP_1b	4.72e-45	80	762	150	658	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ35778.1	0.0	2	912	3	911
VEJ34688.1	1.98e-148	17	904	24	924
QQE47034.1	1.98e-148	17	904	24	924
QQT90658.1	6.14e-147	17	904	24	924
QQY80508.1	1.06e-130	27	900	40	937

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	2.11e-102	39	890	2	865	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3NB6_A	6.90e-42	80	276	23	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	9.41e-42	80	276	23	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3DWK_A	8.79e-34	55	773	5	567	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
4OON_A	2.27e-33	85	695	47	574	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	1.51e-47	33	811	21	695	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
A5I6G4	1.63e-45	1	857	1	720	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.63e-45	1	857	1	720	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	5.07e-45	1	857	1	720	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q891X1	2.25e-42	37	762	41	629	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000005	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
13	35