CAZyme Information: MGYG000000739_01401

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Evtepia
• CAZyme ID: MGYG000000739_01401
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761		83682.14	5.06

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000739	2046079	MAG	Kazakhstan	Asia

• Gene Location: Start: 962; End: 3247 Strand: +

Full Sequence      

MNNERNGRAPAAKPRKHRKRHGRGFKIVMTIVLILVITMAMLLCMSAAYIKNVILPEADL
QLADVSPNLSTTIYCRDPNDANGNYMEVQTLYGSENRIWVGREEIPEDLLNAAVAIEDKR
FYKHSGVDWIRTVKGVTCMFTGAKIQGGSTITQQLIKNITGDDDVTVKRKITEIFRALEF
EKKYDKDDILEWYLNYIYLGEGCRGVYTASYTYFGKHVSQLTLAECASLIGITNNPSKYD
PYSPLKVTDPDTGEVTTAVDFNKRRQETILDAMCEQKMISQEECDAAKAQPLEFKRGQDG
KTQTTIYSWYVEQVITDVMRDLQTTYDLSEERAKDLIYSGGLQIYTCMDYNVQSAVDAVY
NDRANLNYTSATGQTLQSAITVIDNETGNVVAMAGGVGEKTGNRVWNRATKTLRPPGSSI
KPLSVYAPAIELGKITPLSTEVDSPYDTEKGWPVNANGRYVGRESIAQAVQDSTNTVAVK
VLANYVTPEVSYQFMKDKFHITSLVESRAKGDKSFSDIDLAPLALGGLTDGVSTYEMAAA
YSVFPRQGTYMKPRTYTLVLDSNRKTLLSNDSTQETVLSQRTCYYITSMLQRVVAAGTGT
AADFSGQEIAGKTGTTSSRKDLWFVGYTPYYTAAVWTGYDTQERLATNLRNPSTVLWKQV
MSKVHQGVPYQQFTQLSDLVQVSYCTVSGKLPTAACAGHVATAWMSASDAPTSYCDTCRI
VVPDPEPSDDPNGGEDPGGETPPSDGSGETPPAEGGETGGG

Enzyme Prediction     

No EC number prediction in MGYG000000739_01401.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	89	273	1.3e-58	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	2.85e-169	96	667	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.61e-162	22	739	9	661	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.63e-117	26	749	3	795	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.70e-73	80	696	41	592	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	2.30e-68	92	273	8	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALP94484.1	1.12e-225	6	716	8	727
QBB65500.1	1.30e-224	26	716	3	695
QIA31344.1	1.92e-212	26	721	32	727
ANU41033.1	1.03e-211	26	721	8	703
QCI60634.2	8.64e-183	10	696	14	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	3.08e-70	80	687	25	783	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	8.19e-67	179	677	2	470	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	5.10e-62	179	644	2	437	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
3DWK_A	4.88e-50	80	664	12	588	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	6.21e-46	80	648	21	575	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7GHV1	2.77e-100	80	693	61	672	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A5I6G4	8.01e-100	80	693	61	672	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	8.01e-100	80	693	61	672	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
Q0TNZ8	8.22e-99	56	738	58	745	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q0SRL7	9.50e-98	56	715	58	721	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999735	0.000247	0.000001	0.000001	0.000000	0.000046

TMHMM  Annotations     

start	end
28	50