CAZyme Information: MGYG000000988_00054

Basic Information

• Species: Anaerostipes rhamnosivorans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerostipes; Anaerostipes rhamnosivorans
• CAZyme ID: MGYG000000988_00054
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
742		82546.27	9.8247

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000988	3481555	MAG	Denmark	Europe

• Gene Location: Start: 54043; End: 56271 Strand: +

Full Sequence      

MAEETKETKKVISKEKKPKKKKKKRKILLKISIVFLFLVVVGWFTVGIKVMKLRSEAKDL
VANASEQTFKATQTSVVYDTNGKVITKLKGEKDVYYLKYKDLPVYAVAAMISVEDNNFYK
HNGVDFRGIARAAVSFVTNKGSVTQGGSTITQQLARGVFLTREVSWQRKVKEMFVAWDLE
KQYSKDQIMEFYLNNVYFANGYYGIQAASKGYFDKDAKDLTMSEAAFLCAVPNAPNMYEP
YHHKDKTMTRRDKILKDMYKQKLITKSQRDEALKETITLKKKKTEQKRNYIETYVIHSAT
KALMEKQGFEFRYVFDSDEDKQDYDEKYNKAYAECKRTLYSAGYQIHTSIDLDAQKELQN
SIDNALNGYTEKDKNKVYKVQGSGVCIDNETGKVAAIVGGRYQKNVGLGLNRAYQSPRQP
GSAIKPILVYAPAMERGYGPGSILNDNPMSTKDKHRVRNSGGVYSGSITLRRALEKSSNV
ATMRLYEEIGPKAALRYLEKMNFKSLSENDYKYYTTCLGGFTYGTTAEEMASGYAALANQ
GVFRDPTCIVKIEDSDGETVVSNPSKKRTVYSANTASMMSSVLKSVVTNGTGRGAKVPNV
DTAGKTGTTTDNKDGWFCGYTPYYTTAVWVGRDDSKVIPNLTGSTYPKTIWSSFMNALHK
EFSGGKKLESSEGGGGTNMPTTSQTTQGTTENRSTKGTTQATTQATTQATTQATTQATTQ
ATTAATQQQNGGEDGRNSGNDE

Enzyme Prediction     

No EC number prediction in MGYG000000988_00054.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	82	259	2.2e-65	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	0.0	95	660	3	530	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.27e-180	34	664	14	602	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.29e-149	33	660	10	720	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.86e-84	75	661	37	564	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.18e-77	81	259	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP33518.1	0.0	1	742	1	742
BCD34019.1	0.0	1	684	1	684
QMW72903.1	0.0	1	684	1	684
AQP39446.1	0.0	1	663	1	666
CBL38788.1	7.54e-317	1	663	1	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	1.81e-76	61	651	7	753	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	2.28e-69	178	633	2	433	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3DWK_A	9.87e-65	77	636	10	561	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
4OON_A	3.25e-64	77	661	23	725	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3ZG7_B	7.79e-64	178	633	2	433	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40750	4.76e-97	47	659	28	624	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
Q8XJ01	9.69e-88	46	661	46	668	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1
Q0TNZ8	8.40e-86	46	661	46	668	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q0SRL7	2.55e-83	46	660	46	667	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
A5I6G4	2.96e-81	66	659	48	644	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999927	0.000095	0.000000	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
27	46