CAZyme Information: MGYG000001277_00472

Basic Information

• Species: Bilophila sp902373525
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila sp902373525
• CAZyme ID: MGYG000001277_00472
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245	MGYG000001277_3|CGC1	28711.6	11.58

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001277	3409168	MAG	Italy	Europe

• Gene Location: Start: 101210; End: 101947 Strand: +

Full Sequence      

MLKIMWWPLTRVRNWFAVFRRRPVRNIALGLALFLSLDIGRYLFWPPVGRLETENPETTS
FIEYRKEQWEVGRKDGKSLRVRRKWVPLRRIAPSLQKAVVASEDDLFWKHDGFNFSAMYD
ALERNWEKGRMAAGGSTITQQLAKNMWFTPERSVFRKIKEAIMTWRLERTLDKKRILELY
LNVAEWGNGLYGAEAAARHYFGKSAAALTRTEAARLAVMLPSPLRRTPSSPLVRRLASRL
MKRMP

Enzyme Prediction     

No EC number prediction in MGYG000001277_00472.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	81	230	9.2e-58	0.8418079096045198

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	5.97e-85	12	245	1	224	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
pfam00912	Transgly	3.01e-70	80	244	10	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02070	mono_pep_trsgly	7.04e-66	12	244	4	218	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.45e-62	13	244	5	240	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	3.38e-56	82	223	1	142	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAM73242.1	2.67e-72	24	224	4	201
ACF45326.1	4.63e-72	22	229	2	207
ASQ91561.1	2.18e-71	22	231	2	208
ACD91349.1	1.03e-69	24	231	4	209
ACF12295.1	1.58e-69	24	229	4	206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	6.78e-35	82	228	19	165	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.67e-34	82	228	19	165	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.15e-21	98	228	54	184	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	2.15e-21	49	223	3	180	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3UDF_A	9.46e-21	86	228	42	184	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1K3B8	7.34e-54	31	223	13	202	Biosynthetic peptidoglycan transglycosylase OS=Azoarcus sp. (strain BH72) OX=418699 GN=mtgA PE=3 SV=1
Q5P6J8	2.02e-53	55	225	37	204	Biosynthetic peptidoglycan transglycosylase OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=mtgA PE=3 SV=2
A4G8N2	9.40e-52	44	223	26	202	Biosynthetic peptidoglycan transglycosylase OS=Herminiimonas arsenicoxydans OX=204773 GN=mtgA PE=3 SV=1
Q2YBM4	2.58e-51	33	223	12	201	Biosynthetic peptidoglycan transglycosylase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71) OX=323848 GN=mtgA PE=3 SV=1
A6T2A4	3.76e-51	27	223	12	202	Biosynthetic peptidoglycan transglycosylase OS=Janthinobacterium sp. (strain Marseille) OX=375286 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999987	0.000035	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001277_00472.