CAZyme Information: MGYG000001425_00881

Basic Information

• Species: Peptoniphilus_A senegalensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Peptoniphilus_A; Peptoniphilus_A senegalensis
• CAZyme ID: MGYG000001425_00881
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
964	MGYG000001425_2|CGC1	109321.72	6.7627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001425	1816368	Isolate	not provided	not provided

• Gene Location: Start: 77853; End: 80747 Strand: +

Full Sequence      

MKNFAHVKNNFKNLDKKQKIKIGLLILLLIFVLIISLFSALIVSIISKTPATDLNNLSSS
FNQSSYIYSKEGNLIEKIESLEYRTLIDINDIPDNVKNSFVAIEDHRFYKHKGLDPIGIM
SSIAANIKSHSLIRGGSTITQQLVRSVYLTNQKTLGRKIQEAYLSLRVEDVLEKNEILEA
YLNRINLGQGAYGIEAAAQTYFSKDAVDLNIAEAALLAGIPKSPTNYSPFKSVPEEYLKD
DFKVIGTREIDGKDLYMVLNDDAFKRQKIVLMRMHELGYIDDKEYERAKNYDIVNALNPR
NFKNHTMSTYSTDYIKKEASRYLADFYKTSLEEGEHKLFTGGYKVYSTIDENIQKDLEDK
YENFKSFLLNRSSSGGSRMLNLNFDDGNNIIFGDEILYFARNNILDENFNLVIPKSSYSI
SSHDDLKIKSLYFKDLGQRIDIIDAYIIDKNKILNTYEIGGLKIEEGAGELKNNYLIIDG
AYLKDYPDFYRVENDNLIISNKYFDFNPSPLMQPQSAMIVVNNDSGFVEGIIGGLDVRTK
NAKILNRATDSYRQAGSALTPFSVYLPALMEGKTLGDVYDDVPTTVDGMFWPHNYYDSFK
GLMTLRLAMENSSNVIAAEVLKEIGKDKAMDVLKKFEIIREDGDDYFINHSENKKKNDEN
LESLALGNMQVGISLSQLSKMHQTISNGGVYKEETAILKIEDPSGNIIIDNSNKEKKLFD
EKTSHLLKDVFISNSQRGNAKGVHIGKSETGAYLGQNKTNSDYFVNGFNKSHTISLWVGA
DSPKISLTSDKSAAIDLFNTMTKNLSKAENFDEDPSYIVTRKISSKSGKLATKMSDYAGA
SYSEKYISGTEPSEQDDLFKKYLICKDSNKLATQFCPSESVLYTVRFERKDKYDAKDHYG
IYPDDYMTLPKEHCDVHTREWYNEFGEEENNSPKKDKAKKSSKQEKSKKSSDKIKTSKTS
KKKK

Enzyme Prediction     

No EC number prediction in MGYG000001425_00881.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	72	236	5e-62	0.9152542372881356

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	4.63e-126	83	804	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.08e-122	40	859	33	657	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.45e-115	41	858	26	770	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.19e-75	71	275	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
PRK11636	mrcA	2.99e-62	67	855	50	831	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT90658.1	0.0	1	924	1	924
VEJ34688.1	0.0	1	924	1	924
QQE47034.1	0.0	1	924	1	924
QAT62113.1	1.19e-203	41	925	38	937
SHD77321.1	2.50e-203	17	920	14	929

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	1.36e-154	50	910	6	865	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
5U2G_A	3.49e-59	63	705	20	560	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
4OON_A	3.38e-49	67	784	23	699	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2OQO_A	2.45e-48	81	290	17	199	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	8.53e-48	81	290	17	199	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0SRL7	5.31e-70	8	854	15	719	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q8XJ01	7.71e-70	8	798	15	658	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1
Q0TNZ8	5.46e-69	8	854	15	719	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
A7GHV1	8.82e-66	12	891	5	733	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A5I6G4	4.28e-65	12	891	5	733	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999767	0.000089	0.000000	0.000000	0.000000	0.000171

TMHMM  Annotations     

start	end
20	42