CAZyme Information: MGYG000002400_00647

Basic Information

• Species: Staphylococcus lugdunensis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus lugdunensis
• CAZyme ID: MGYG000002400_00647
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A/1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731		80997.01	9.4756

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002400	2523999	Isolate	not provided	not provided

• Gene Location: Start: 228275; End: 230470 Strand: +

Full Sequence      

MTEKQGSSQPKKGNNGKSKQKQNKSVKRTIIKIIGFMFIAFIILALLGILLFAYYAWKAP
AFTESKLQDPAPAKIYDKNGKLVKTLDNGARREHVDLKNVPKNMRNAVLATEDNRFYEHG
ALDYKRLFGAVGKNLTGGFGSQGASTLTQQVVKRSFLSEEKSIGRKAQEAYLSYRLEQEY
SKDDIFQMYLNKIYYSDGVYGIKAAAKYYFNKDLKDLNLAEEAYLAGLPQVPNVYNIYDH
PKEAENRKDTVLYLMHYHNRISKKEWEQAKKTSLKDNLVQRGTKERQTGTKNQDTDYDSY
VNFVKSELMNNDKFKNQNLGDVLQSGIKIYTNMDKDVQKTLQNRIDNGNFYKNDDQQVGS
SIVDSKTGGLVAISGGRNFRDVVDRNQATDPHPTGSSLKPFLAYGPAIENMQWATNHAIQ
DESSYQVEGSTFRNYDQKGHGTVSMYDAIRQSFNIPALKTWQATRSQAGNNAPKKFASKV
GLDYKNEIGPSEVLGGSSSEFSPTQLASAFASIANGGTYNNAHSIQKVVTADGETIEYDH
SSHKAMKDYTAYMLAEMLKGTFSAYGSAYGHGVSGVNIAAKTGTGTYGEEVYQKYNLPDS
AAKDVWINGFTPKYSMSVWMGFKEVKQYGTNSFVGHSEQEYPQYLLEEVMSDISPRDGSD
FSKPDSVSGSNKESLSVANHPDNNTTGRKVYGSSGSSDSTSSSNRSSNSNTSSGARNNSS
STGGLSSVFGR

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	80	255	3.6e-63	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	0.0	54	669	37	612	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	4.00e-151	91	655	1	530	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	2.11e-91	30	622	1	691	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.52e-82	79	256	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02071	PBP_1b	4.06e-73	81	621	134	656	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST60048.1	0.0	1	731	1	731
ATN14175.1	0.0	1	731	1	731
QRF15508.1	0.0	1	731	1	731
BBN85445.1	0.0	1	731	1	731
ARJ11499.1	0.0	1	731	1	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	0.0	67	691	2	625	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	0.0	58	694	2	637	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	1.55e-47	176	622	3	432	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
2JE5_A	1.94e-45	73	655	35	638	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]
3ZG7_B	1.71e-41	176	622	3	432	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	9.31e-115	10	681	22	676	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q00573	6.02e-100	27	622	3	600	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q04707	4.10e-94	27	622	3	599	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	1.12e-93	27	622	3	599	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P38050	8.54e-88	27	667	7	610	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999957	0.000061	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
33	55