CAZyme Information: MGYG000002416_00335

Basic Information

• Species: Hydrogeniiclostridium mannosilyticum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Hydrogeniiclostridium; Hydrogeniiclostridium mannosilyticum
• CAZyme ID: MGYG000002416_00335
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771		85123.75	4.4143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002416	3014016	Isolate	Russia	Europe

• Gene Location: Start: 359148; End: 361463 Strand: -

Full Sequence      

MRKTDLNKYANGQTNPQNQAALTFRAVGKAIWKLLVTAFVVAFITGIIVSVSLFSYVMSM
KDSKIEYDLMDLKLNYTSFIYVNGENDDSGNPVQYQSLYSGENRVWVNYSDIPQAMKDAM
IAIEDKRFEDHNGVDWIRTIGAVYNLVTHSKGSYGGSTITQQLIKNLTGENDVSLSRKVK
EIFRALNLEKEYSKEQILEVYLNVVDFGSGCKGVQSAANLYFGKDIQDCDIAECAAIAGI
TQNPTAYTPLVYPEANQRRQRIVLDQMLDQEKITQEEYDAAYEKSGHMEFVGRTSENVVD
SVPIWDWYTEQVFKDVRRDLMEKYECTQAEASDMIYHNGLRIYSAQNTELQTIAEEALSD
RSIFTQDPGAQGGFLAMDYNGRVLATVGRVGAKYLNLGTSYATETNRQPGSSLKPLVDYA
PGLEAKVINYSTILDDNPVDGYLNGDGSPGPNNYDPVFEGDVTVKRALQVSKNPPAVRVL
LSVGIQNAVSFLEDKLNFSPIATDMQVPSMAIGGSFGTNIREMVGGFQIFGNGGKFYEPY
TYYYVTDHDGNVILDNRETAPVQAISSVNASIMYRLLENVIQAGTGRLAALDGWQVYGKT
GTTQDRKDLWFIGGTPYAVGGVWTGYASYKRQMDDEDIAKKIWKNIMSQYLSNKEAKQFT
LDPDMISAKFCVETGKLENPGVCSETELGWYSRDNLPSICDGEHEGAESSEPVSSEASSE
PPRVSSSETTQSGPVVVPSSSAESSEPASSENEQSSSEADSNSSSHNKPSD

Enzyme Prediction     

No EC number prediction in MGYG000002416_00335.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	100	267	1.1e-63	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	1.28e-166	103	653	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.56e-147	32	689	10	636	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.04e-124	99	681	62	749	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.03e-77	99	268	8	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	1.74e-66	101	625	55	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK41697.1	1.35e-281	1	717	1	721
QEY34222.1	3.70e-277	1	709	1	709
QAT49292.1	4.10e-276	1	722	1	726
CAB1249043.1	2.98e-263	1	701	1	702
QNO19068.1	1.28e-238	1	720	1	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	3.54e-52	97	699	32	771	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	1.31e-51	87	659	12	596	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
3ZG8_B	1.56e-49	188	626	3	432	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
7U4H_A	1.92e-48	102	681	38	792	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
2OLU_A	4.43e-47	87	659	21	605	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q891X1	2.68e-82	91	701	56	711	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
A7GHV1	1.78e-78	87	677	61	670	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A5I6G4	1.31e-77	87	677	61	670	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.31e-77	87	677	61	670	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
Q97GR5	6.15e-76	72	657	68	673	Penicillin-binding protein 1A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000023	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
34	56