CAZyme Information: MGYG000002491_00072

Basic Information

• Species: Kluyvera ascorbata_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata_B
• CAZyme ID: MGYG000002491_00072
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772	MGYG000002491_1|CGC1	84963.86	10.113

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002491	5264779	Isolate	Spain	Europe

• Gene Location: Start: 80835; End: 83153 Strand: +

Full Sequence      

MRVAWLKRLVWRWLAGAVVLFCGAVVLADKRWPLPLHEVTPARVVVAEDGSPLWRFADAE
GIWRYPVTVEEVSPRYLDALIQYEDRWFWDHPGVNPFSIARAAWQDLSAGRVVSGGSTLT
MQVARLLDPHPRTFGGKFRQLWRAFQLEWHLSKRDILTLYLNRAPFGGTLQGVGAASWAY
LGKPPAQLSYADAALLAVLPQAPSRLRPDRWPHRAQAARNKVLDRMLTQGVWPDAAVKEA
KEEPVWLFPRQMPQLAPLFARAMLARSREEKIVTTLDAGLQRQLEDLAMNWKSRLAPRSS
LAMVVVDNRDMKVRGWVGSADITDDSRFGHVDMVTAVRSPGSVLKPFLYGMALDSALIHP
ASLLQDVPRRVGDYRPGNFDSGFHGPVSMSEALVRSLNLPAVQVLDAYGPKQFAARLRNA
GLPLILPTGAEPNLSLILGGAGARLADITAAYSAFARHGRVGKLRMLASDPLVERPLLSP
GAAWIIRRILANEAQPLPDASLPQGVPLAWKTGTSYGYRDAWAIGVNARYSIGIWTGRPD
GTPVAGQFGFASAIPLLNQVNNLLASRAARQQEARDPRPASVGVAEICWPAGQPLPAGDT
NCRRRLSTWMLDNSLPPTLQLPEQEGMQGIRFPMWLDGEGKRVAADCPGARETILDVWPL
PLEPWLPVGERRAARLPPVSTRCPPRQVQNMAPLMLSGIREDAVIRRLPGESNARVVLHA
SGGEGRRWWFLNGEPQASAGDSLTLTLADPAAYQLVVMDEAGQTSVVNFTLQ

Enzyme Prediction     

No EC number prediction in MGYG000002491_00072.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	62	226	1.4e-51	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4953	PbpC	0.0	11	772	4	732	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02073	PBP_1c	0.0	33	769	1	724	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK11240	PRK11240	0.0	6	772	4	772	penicillin-binding protein 1C; Provisional
COG0744	MrcB	8.79e-112	1	546	9	581	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	5.12e-108	64	537	2	500	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBR19821.1	0.0	1	772	1	772
BBT69993.1	0.0	1	772	1	772
BBS90711.1	0.0	1	772	1	772
BBT00764.1	0.0	1	772	1	772
BBR59954.1	0.0	1	772	1	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	2.54e-38	45	556	23	714	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	3.31e-32	77	543	169	673	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
2OQO_A	3.43e-32	64	240	20	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3VMA_A	3.55e-32	77	543	190	694	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3NB6_A	1.18e-31	64	240	20	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	0.0	7	772	7	770	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
P38050	1.44e-47	19	537	30	569	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O66874	1.18e-40	6	537	1	639	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q9KUC0	2.94e-40	77	543	193	694	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
Q07806	8.70e-38	14	556	15	741	Penicillin-binding protein 1A OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mrcA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999194	0.000786	0.000042	0.000002	0.000001	0.000008

TMHMM  Annotations     

start	end
9	28