CAZyme Information: MGYG000002846_00456

Basic Information

• Species: Desulfovibrio sp900540515
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio sp900540515
• CAZyme ID: MGYG000002846_00456
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767	MGYG000002846_3|CGC2	82619.88	9.3112

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002846	3432213	MAG	United States	North America

• Gene Location: Start: 34110; End: 36413 Strand: -

Full Sequence      

MGLPLLLCCAALAFALALYATPRPDIYGRAGFSRSFLDRQGRVLRITLAPDGAYRIFTPL
TALPPELIEATLLYEDRFFFRHPGVNPLSLLRSAVSMVLGGRRMGGSTISMQVARLSGKF
STASIPGKLRQIWHALALERHYDKDEILEAYLNLAPYGANVEGAGAAARVWFHKEAGELS
LPEILALAPVPQHPAARNPLTSRGRALSQARARLDKIWRQAHPRAAGQGLPDVPLRVHGP
SELPFAAPHAVDSLLAAPDLPQGDIVTTLDLGLQRLLERQLRRAVEAGRLWGMDNAAALL
LDWSSGEILALAGSADYFNAAIQGQVDGTAARRSPGSTLKPFIYALALQEGLIHPESLLS
DTPRVFKGYEPENADGGFRGPVSARMALLGSRNIPAISLAGQLPAPGLYGFLRKAGVRFE
HGPEHYGLSLVLGGAEVSMRELAGLYAVLPNRGVWRAPMLRRDEAAPEPLPLLRAEAAFV
ALQMLRAPSPQGFDRTPVYWKTGTSNGLRDAWTAGIFGPYVLVVWVGRFDGASNPGFNGL
HAAAPVFFSIQRALEAQSPPGAPADPGANADGLKVRRIAVCAATGDTDLSLCPEPSRQTG
TWFIPGVSPIRDSGILRRILVDEVTGFRQCRAVPGRTREVVWEFWPADLRRLFTQAGVRK
PAALPLAPECRDTDAPWQVPGRAPLISSPKSGLIYTASLGNPQKIPLLADADADADCVYW
FAGARYLGRSAPDEPLFWQAAPGVTRLTAVDDLGRSSSVRVVTESVP

Enzyme Prediction     

No EC number prediction in MGYG000002846_00456.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	54	215	2.1e-42	0.9152542372881356

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	0.0	33	764	11	727	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	0.0	32	761	35	729	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.31e-101	54	547	1	521	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.00e-100	36	601	58	646	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	3.45e-98	51	681	58	698	penicillin-binding protein 1C; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD89899.1	0.0	2	767	15	780
QTO41888.1	1.14e-250	13	767	28	771
QCC84882.1	4.17e-249	10	761	51	791
SPD36822.1	2.33e-237	31	767	46	772
ATD81196.1	2.33e-237	31	767	46	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	7.48e-29	63	530	47	696	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	4.54e-28	63	550	47	711	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
2JE5_A	1.06e-23	66	559	65	638	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]
3NB6_A	2.03e-22	19	222	4	188	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.76e-22	19	222	4	188	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	1.69e-83	51	762	60	768	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
Q9KUC0	3.88e-39	55	530	180	691	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
Q9PGD4	1.80e-34	63	552	78	752	Penicillin-binding protein 1A OS=Xylella fastidiosa (strain 9a5c) OX=160492 GN=mrcA PE=3 SV=2
O66874	1.28e-33	55	559	63	672	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P38050	2.15e-33	60	527	72	569	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.861432	0.136786	0.001305	0.000148	0.000112	0.000224

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002846_00456.