CAZyme Information: MGYG000003581_00321

Basic Information

• Species: HGM12814 sp900770165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; HGM12814; HGM12814 sp900770165
• CAZyme ID: MGYG000003581_00321
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777		85705.28	4.6985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003581	2356172	MAG	Fiji	Oceania

• Gene Location: Start: 14255; End: 16588 Strand: +

Full Sequence      

MRKTNINKYRGANKNSSFNNTGETDSTRKLILKVLSKAFITFITIFLVVSIVVVSSLIVY
TIKLSSDEIDYDITAAKLHLTSMIYVNDENGNPQEYSSFHSTENRLWVDFSDIPDNMKNA
VIAIEDKRFWEHNGVDWVRTCGATLNLITGRDSYGGSTLTQQLIKNLTDDNEVSLTRKLR
EIFRALNFEKKYSKDEIIEAYLNVVNFGNGCRGVQSAANTYFNKDIEECNAAECAAIAGI
TQNPSAYNPLIYPENNKTRREVILNEMHSQGMLSDDEYNQAMEESKNMVFTDSVEDFEEK
DEKGEFRNWYIDTLYNDVHRDLMERLGMGEAAATDMILTQGLKIYCSMDKNAQEIAENVA
KGSSVVPNDEDLQLGYFMMDYSGRVLAVIGGKGEKQGDLIFNMATDAIRQPGSTIKPIGV
YAPAIDLGILNYSSIIKDEPITKLNDSPWPKNSYGSYRGNITVQNAIQNSSNAAAVQALA
SLTPQKSAEFLKNKLHFTTLEAEDAQGYSAYATGGMTKGVTVREMTASFQIFGNGGMYYK
PYTYFKVVDRNGKVLLDNENQVPTQAISSQTATIMNRLLRTVVTSGTGTPANISGWDIFG
KTGTTDNNNDSWFVGGSPYAVAGTWIGYKIPESIPYYTAARNIWRTIMSQYLEGKAVKDF
VFDQSVKTATYCEVTGRIADTDICGPKKTGYYAPNNMPGGCGGNHAYVNSDGENNAENSQ
EQNQESSVASSSSAPQSTDSSEQELNSSSASSASSQASQPSSNTEMTTSSSSAENRR

Enzyme Prediction     

No EC number prediction in MGYG000003581_00321.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	97	268	8.2e-65	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	3.35e-169	104	654	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.22e-160	62	663	36	608	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.03e-122	64	725	30	795	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	7.41e-82	103	650	145	681	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	1.60e-79	101	268	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK41697.1	2.90e-246	1	711	1	714
CAB1249043.1	2.04e-244	1	698	1	698
QAT49292.1	7.98e-239	1	741	1	746
QEY34222.1	2.15e-236	1	710	1	709
QCT07186.1	1.06e-216	27	711	70	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZG8_B	1.38e-64	189	658	4	462	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
7U4H_A	7.05e-64	88	660	25	769	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG7_B	9.72e-58	189	658	4	462	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
3DWK_A	3.38e-56	86	629	10	558	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	6.44e-53	74	629	7	567	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XJ01	1.06e-88	52	664	43	673	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1
Q0SRL7	2.12e-88	59	684	50	697	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q0TNZ8	3.58e-88	52	664	43	673	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q891X1	6.06e-86	92	699	56	707	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
A7FY32	2.43e-83	101	678	72	670	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999956	0.000029	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
38	60