CAZyme Information: MGYG000003671_00474

Basic Information

• Species: HGM10818 sp900772445
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; HGM10818; HGM10818 sp900772445
• CAZyme ID: MGYG000003671_00474
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1041		117574.22	7.517

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003671	1177326	MAG	Peru	South America

• Gene Location: Start: 35938; End: 39063 Strand: +

Full Sequence      

MKDFIKKINVFDIIIGILFLVINILSFILFKWLGLLSIPIFGVLIFIYYNSKEIGNMISE
LINKNNKSKNKKNNKGKNNKTNNKSIKNSKNKNKNNSIDDEFDDDDDIIIKKKKTENVYE
TKDVDMVKINNKKKGKSKKNNKSKTKKKVNKEKKTGKQILKSILIVVFSFCIFCVLSLAA
FLTYIVITTPNFDPDKLTYKDQTVVYDKNSVAFATLGTQKRESVTYDELPQVLVDAIIAT
EDSRFFQHNGVDFARFLKASFEQLLHIGTGGGASTLTMQVSKNNLTNTESRGIKGIIRKF
RDIYISVFQIEKKYTKEQIIEFYVNDNLLGGSNYGVEQASQYYFGKSVSELNLAEAATIA
GIFQSPNAYRPDRNPEGAEKRRNTVLYLMKRHGYITEEEEAITKAISVESLVVSHPENET
YQGFLDTVTAEVESKTGNNPYEIPMKIYTTLDTTVQNGIDDIMEGKTYTWQNDVVQAGVA
VVDVNTGEVIAIGAGRTKDILGGWNYATQERNHPGSTAKPLFDYGPGFEYSNYSTYTLFN
DEPWSYTNGPAVNNWDSSFHGLMTLRTALSQSRNIPALKAFQQNNKKNILDFVTKLGITP
ETPLHEAHAIGGFNGVTPLELSAAYATFANGGYYIEPHTVTKIIYRDNDKEEEFKYTKER
VMSASTAFLINNVLQYAVETGYGGGARVYGKTVAAKTGTSTYGDDIIEKYGMGYDAVNDL
WTAAYTPQYSFALWYGYKERSSEYYNTNTTGAVYKNNLMSALVKVIPMTDKAFDVPDTVV
QSQVEFGTWPAQLPSEYTPKDLINTEYFIKGTQPTETSQRFTKFTDVKNLETTKINNNTV
ELTWNYDMPEIFTETYLKKYFSQNVFGNGTDSFVKNRLNYYGGVGYGIYTIDENNNLTKI
DFTTDKEYRYTNTTSKDVHIVVKVQYKDFDGNASNGVENDILIRGKNSNSNSDSKLTTNI
NSSGTYNVGNYVESDFTIKYNGRTISKDEVTIKYSVNGVEYFDKEDLVSSINSLSSGTYT
ITYTISYKDETEKFTKRITLN

Enzyme Prediction     

No EC number prediction in MGYG000003671_00474.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	213	390	4.7e-56	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	2.39e-155	155	822	8	657	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	8.20e-108	157	840	2	783	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	2.46e-76	176	736	7	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	3.30e-73	219	705	145	639	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	6.32e-67	209	390	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF30636.1	1.11e-152	185	847	62	725
APH04640.1	1.34e-149	185	851	57	720
AYA76804.1	1.26e-148	179	847	53	726
AWI12666.1	3.08e-148	184	847	55	716
QNG61477.1	3.67e-148	158	846	33	717

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	2.57e-83	205	739	10	559	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	6.01e-80	190	739	4	568	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	1.11e-58	309	752	2	447	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	2.38e-55	309	752	2	447	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
4OON_A	1.97e-45	205	737	23	718	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	9.65e-140	190	852	64	735	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q00573	7.00e-95	184	740	34	603	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q04707	1.61e-87	184	740	34	602	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	5.85e-87	184	740	34	602	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P38050	7.01e-73	176	800	22	632	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999994	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
33	50
163	185