CAZyme Information: MGYG000003759_01263

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; KA00134
• CAZyme ID: MGYG000003759_01263
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808	MGYG000003759_50|CGC1	90014.93	5.9556

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003759	1433538	MAG	Canada	North America

• Gene Location: Start: 4907; End: 7333 Strand: -

Full Sequence      

MKKKKKQKKGFRFSSFIVILILLVLMAATAGAALVASYVLSVVEEAPPIDPENFRARIME
TSKIYTVKGEPLETLVQNEFSEYVTIDKIPDDLKNAAVAIEDMRFYEHSAIDFKRVMGAI
VENIKAKRFKEGASTITMQLAKNLYTGTQKDMTRKLTDVYYSFQMENVLSKDQILEAYLN
SSGFSKGAVGVQAAAKSFFNKNVWDLNLAECALIAGVTNRPEAYTPYNSMPIEYGVDDLS
TLQVVTIPLKDITVDEHTNAIAEELRALNKIDSFEEFQIKQGQLAPMKAVFNPSSKERQE
RVLKKMWEQGKIDQAQYDTAVATPIVLNLGRRNKFGISSHYLDIAKDETIEILKDLGYED
VEAHNRLYNGGLKIYVAMDMEIQKSLEKSASEIKLSGEKVNENGELQPQIGAVVMDPYNG
HVLGIIGGRKVGGGRITNRATLPRQPGSSIKPISVYLTAFNNGATAGDIYLDQSLQGLNL
PYLNYAPKNVGSYRGWQSIRQLLVQSSNVGTYLVARDLSANLESKQNKYSQYSKVVNNDE
NFKKMVTTLEELGVSTIVHPKDSPTNDYNYAALTLGGLTKGISPLEMAAAYSVFPNKGEV
HKPVFITQIESSDGKVIYKNPESKTRVTSEQNAYIMTDILKDVVKKSTGRRAQIKNMTIA
GKTGTTNDKKEVWFVGYSPYYVCSVMLGNDDHTPLKFNSLTAAGIFADLMGPIHEGLENK
DFVMPDKINRKYISALGYTELIPEGYTPRNQDKPAYFAPEEEEDEDGEGGVETTDKEGRE
GGRESNREGSERRNSERNNSDHRNDDDN

Enzyme Prediction     

No EC number prediction in MGYG000003759_01263.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	69	229	1.4e-55	0.8983050847457628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	9.64e-156	82	716	3	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	7.63e-145	38	722	34	605	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.65e-117	18	759	13	760	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.61e-64	69	229	2	161	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	1.97e-54	68	751	43	605	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDZ74476.1	2.42e-255	39	757	40	757
AHZ59614.1	5.15e-252	33	762	35	763
AHZ59612.1	7.29e-252	33	762	35	763
QQT91383.1	4.86e-251	33	757	35	758
QQE47660.1	2.76e-250	33	757	35	758

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	5.57e-84	43	734	2	782	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3DWK_A	1.24e-55	62	688	8	556	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	6.57e-53	62	688	17	565	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	1.02e-48	164	690	2	433	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
4OON_A	5.65e-48	63	711	22	720	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	2.61e-88	39	751	35	687	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	2.61e-88	39	751	35	687	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	3.41e-88	39	751	35	687	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q891X1	1.09e-81	40	757	40	700	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
Q97GR5	1.01e-78	39	730	51	683	Penicillin-binding protein 1A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.731059	0.209325	0.003853	0.001848	0.000943	0.052995

TMHMM  Annotations     

start	end
13	35