CAZyme Information: MGYG000004236_00351

Basic Information

• Species: UMGS1071 sp900542375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1071; UMGS1071 sp900542375
• CAZyme ID: MGYG000004236_00351
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A/1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751		82157.57	4.3292

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004236	2130526	MAG	United Kingdom	Europe

• Gene Location: Start: 4260; End: 6515 Strand: -

Full Sequence      

MKKSDINQYGLKPVPDPKGNSTGKAAGKAISRVVITIVSLFFATLFIIGIFMFSYIMSLR
GEEIDIDLHSLNLDYTSFIYVNDESGNPVEYKSLYGGESNRIWVDYQDIPQYMKDAMVAI
EDKRFWEHNGVDWWRTLGAASNLLSSGGSFGGSTITQQLIKNLTGESDVSISRKLKEIFR
AENLEKKYTKEEILECYLNVVNFGSGCKGVQAAANLYFGKDIKDCSLAECAAIAGITQNP
YAYSPMNFPDQNKERQQIVLSEMYNQEKITKEEYDQAMSESENMNFVFQEATETGADDTI
NNWYIDTMIQDVVSDLQSELGYTKEDAQNMIYYGGLKIYSAMDSSAQEMAENAVANDRNL
NSDPDMQCGVYMMDYSGRVLAIVGSSDEKEGNMWFNYATDAKRQPGSSFKPIAAYAPAID
KGIINYSSIVQDEPIPNYFDDGTAGPNNYDHQFRGPVTVQYALQQSYNPPAVRVYQQLGP
QNAYNFLTQKLGFTSLVGGGVDDSNLGVAIGGVHEGVTVKEMTAAFQIFGNGGQYNEPYT
YYYVEDHDGNVILDNRDNISTQAIKSSTATIMQKLLTTVVTQGTGTGAGVTGWQIYGKTG
TTDIDDNSYFVGGSPYAVIGVWTGYQNPSRLRNTNASKSVFQSLMGAYLNTKQLKQFTTD
SSVTSAVYCTQSGNLAGPGCPTATGWYERSNMPSECTQHQNTNTTSSRSEEEEESSSSNT
SSSESSSSSSSSSSSSSSSSSASSSSSSSAA

Enzyme Prediction     

No EC number prediction in MGYG000004236_00351.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	98	264	8.4e-64	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	6.66e-156	100	649	1	529	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	7.01e-150	23	658	4	606	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.62e-104	97	682	63	752	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	9.77e-68	97	264	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	3.58e-61	81	624	39	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1249043.1	2.10e-268	1	694	1	699
QNK41697.1	1.64e-259	1	696	1	704
QAT49292.1	2.04e-258	1	702	1	711
QEY34222.1	4.15e-253	1	696	1	700
CAB1248777.1	1.93e-229	1	696	1	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	3.14e-65	81	625	10	557	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	5.55e-61	81	625	19	566	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	1.59e-55	184	666	3	474	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
7U4H_A	6.96e-55	100	683	39	796	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
4OON_A	4.85e-50	97	683	35	757	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q891X1	6.20e-79	83	681	52	691	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
Q0TNZ8	1.17e-76	47	701	45	726	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q0SRL7	3.61e-76	55	703	49	728	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q8XJ01	4.87e-75	47	656	45	673	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1
A5I6G4	5.62e-75	71	675	51	670	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999956	0.000030	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
34	56