CAZyme Information: MGYG000002870_00631

Basic Information

• Species: CAG-605 sp900545005
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-605; CAG-605 sp900545005
• CAZyme ID: MGYG000002870_00631
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584	MGYG000002870_6|CGC1	69126.61	7.3584

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002870	1225239	MAG	United States	North America

• Gene Location: Start: 64502; End: 66256 Strand: +

Full Sequence      

MNLLYCGDSNIKDGLYLSIRSILEVEKGILNIYVLSMNYLDYKMIDREFIYSLDTLVKSV
NKDSKVSLIDMSDVYKNNECKANKDTLFTPYCMLRLYADLVELPKKILYLDTDVLAYKSF
KEFYEIDNSTYEVVGALDYYGSHIYKKNIFKRDYLNSGVLLLNLDLLKKNDILKKARELC
ASKKMLLPDQSALNILCKHKLIVDRKYNEQKSMQKDTVFRHFTTTFKFFPVIKTQKVKPW
QIDRVHEILNCHEFDWLLREYKEWKMQNSKIIPVFFTIDDNFAPFLSVALKSLLDKASQE
YFYNIHIVNNGLSEENKNKILSLETDYAKIMFNNMDERLRTITDKKGTRLREDYFSLAIF
FRIFIPDCFKEYDKAIYIDSDTLVLDDISKLYNIDLGDNYIGGCTETSCLGMDDITNYFT
NGVGVNYKEYMNSGMLVFDMKALREHHFAEKFLYLFKKYNFGNVDPDQSYINAILKNKKL
LIDNRWNATVSKDNKLIDNPGIIHFNLFKKPWHYDNVAGEKYFWEYAKKTPYYEEIKRIK
DNYTLEDKKKDDECLNSMIRRCREIVNDDVTFKSVFDSGKEERL

Enzyme Prediction     

No EC number prediction in MGYG000002870_00631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	266	515	1.6e-53	0.9027237354085603
GT8	2	241	9.4e-28	0.867704280155642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	9.11e-65	272	514	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	1.66e-39	271	559	2	295	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	2.21e-39	273	515	1	251	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd04194	GT8_A4GalT_like	4.97e-23	1	242	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
cd00505	Glyco_transf_8	1.72e-18	274	514	4	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72462.1	5.26e-138	1	578	1	590
QAT42779.1	4.39e-89	272	584	8	320
AHA96562.1	5.69e-85	272	584	3	316
QLL67411.1	1.24e-83	272	584	3	316
AZZ66627.1	1.74e-83	272	584	3	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	7.79e-21	272	536	302	592	ChainA, WbbM protein [Klebsiella pneumoniae]
1SS9_A	2.98e-15	272	527	1	268	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	1.30e-14	274	527	3	268	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
5GVV_A	1.55e-11	360	527	88	251	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVW_A	1.55e-11	360	527	88	251	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43974	1.43e-22	269	524	36	278	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
P25148	6.36e-21	266	512	1	255	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
A0A0H2URJ6	8.49e-11	360	527	88	251	Glycosyltransferase GlyE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyE PE=1 SV=1
Q8GWT1	3.72e-10	210	512	228	502	Probable galacturonosyltransferase 14 OS=Arabidopsis thaliana OX=3702 GN=GAUT14 PE=2 SV=1
A0A0H2URH2	1.06e-09	354	524	77	241	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002870_00631.