CAZyme Information: MGYG000001035_00709

Basic Information

• Species: Pseudomonas_E putida_P
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E putida_P
• CAZyme ID: MGYG000001035_00709
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484		53931.05	9.7551

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001035	3564571	MAG	Sweden	Europe

• Gene Location: Start: 3423; End: 4877 Strand: -

Full Sequence      

MLNLKNERTLWWVLGSILLLRLVGLGIYPLMDTSEARYAEMARKMVELNDWITPMFDYGV
PFWGKPPLSFWTQAASMTVFGVNEFAARFPAWLLHLASCFIIIKLGTQQISRNAGIWAAI
IFSSTTLGLVSSGVVLTDPVLSFSILLASYGFWRWMKCASKADAYLMFAGLGLGLLAKGP
LTLVLMGAPAFAWFVIYKEWGRVLRLPWISGLVLMFGISVPWYVAAEMKTPGFMEYFFVG
EHWSRYVVSNWAGDLYGSAHAKPYGSIWIQLGLSLLPWALFLPLLIRKRGSMQRFKAYLW
LWALATPVFFTFAGNILWTYLLPALPAWALLLSARVSEVGPKTTWAAAASALVLPIIGAG
IIYAGVLEERPQNQRDVVQAWLNVQSAHSAPLIYPGRRSYSSEFYSSGKSENIKDPAKWP
RDGSFYLSRRLRDSKDGLPADLACTSITEANASQLLLCHWKRPAQGAEGLAGESNAETPR
KNEG

Enzyme Prediction     

No EC number prediction in MGYG000001035_00709.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	372	1.9e-98	0.6703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.01e-43	10	357	10	357	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.99e-17	3	338	1	335	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	9.62e-14	32	237	29	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	1.65e-10	65	223	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVD80780.1	0.0	1	484	1	484
ATP42543.1	0.0	1	484	1	484
QOC98197.1	0.0	1	484	1	484
ATN09723.1	0.0	1	484	1	484
QDW55376.1	0.0	1	484	1	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	5.41e-27	6	343	28	371	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BDQ8	4.70e-26	11	371	7	367	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
Q3KCB9	2.19e-24	13	338	10	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT2 PE=3 SV=1
A4WAM1	2.23e-24	4	338	1	334	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1
Q3KCC9	1.40e-23	11	336	23	350	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
A0KGY4	1.71e-23	9	335	4	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000005	0.000001	0.000000	0.000000	0.000009

TMHMM  Annotations     

start	end
9	31
85	107
114	136
175	197
204	226
264	286
299	321
345	367